BioLiP

>protein
NKLYKNIEIDTDTHSVYIHSILLNLTLTEYKIISFMIDQPHKVFTRGELMNHCMSDALERTVDSHVSKLRKKLEEQGIFQ
MLINVRGVGYRLDNP

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5x5l:E	98	98	0.9789	0.9490	0.9490	9.71e-62	5x5l:B, 5x5l:H, 5x5l:A
2	2z33:A	104	93	0.3368	0.3077	0.3441	1.58e-15	1gxp:A, 1gxp:B, 1gxp:E, 1gxp:F
3	7e1b:A	209	90	0.3684	0.1675	0.3889	3.04e-13	7e1b:B, 7e1b:C, 7e1b:H, 7e1b:D, 7e1b:E, 7e1b:F, 7e1b:G, 7e1h:A, 7e1h:B, 7e1h:E
4	4b09:A	218	89	0.3474	0.1514	0.3708	9.05e-12	4b09:B, 4b09:C, 4b09:D, 4b09:E, 4b09:F, 4b09:G, 4b09:I, 4b09:K
5	8hig:A	98	90	0.2947	0.2857	0.3111	3.46e-11	8hig:B, 8hml:A, 8hml:B
6	2oqr:A	226	91	0.2737	0.1150	0.2857	8.28e-09
7	2gwr:A	225	92	0.3158	0.1333	0.3261	9.87e-09	3nhz:B, 3nhz:C, 3nhz:D
8	8hih:O	217	91	0.3158	0.1382	0.3297	5.92e-08	8hih:P, 8hih:N, 8hih:Q
9	5ed4:E	224	95	0.2842	0.1205	0.2842	9.21e-08	5ed4:A, 5ed4:B, 5ed4:F, 2pmu:E
10	6lxn:A	110	91	0.2421	0.2091	0.2527	1.88e-06	6lxn:B
11	1ys6:B	227	89	0.2526	0.1057	0.2697	1.39e-05	1ys6:A, 1ys7:A, 1ys7:B
12	6cqg:A	98	93	0.2842	0.2755	0.2903	0.004
13	4nhj:A	102	91	0.2211	0.2059	0.2308	0.18	4nhj:B
14	2mow:A	161	44	0.1474	0.0870	0.3182	0.69	6gc3:A, 2lo6:A, 6o3w:A, 6o3w:B, 6o3x:A, 6o3x:B, 6o3x:C, 6o3y:A, 6o3y:B, 6o3y:C
15	8ih7:A	340	43	0.1368	0.0382	0.3023	0.77	8ih7:C
16	7x7q:A	185	30	0.1053	0.0541	0.3333	5.6	7x5a:A, 7x5a:C, 7x5a:F, 7x5a:B, 7x5a:G, 7x5a:D, 7x7q:C, 7x7q:F, 7x7q:D, 7x7q:E, 7x7q:H, 7x7q:B
17	8tlq:A	1283	90	0.2737	0.0203	0.2889	7.8	8tlt:A, 6v93:A
18	5afq:B	444	64	0.1579	0.0338	0.2344	8.1

[Back]