NGEIISGFIAPHPPHLVYGENPPQNEPKSTGGWEQLRWAYERARASIEELKPDVLLVHSPHWITSVGHHFIGVDHLQGRS
VDPIFPNLFRFDYSINFDVELSEACCEEGRKAGLVTKMMRNPRFRPDYGTITTLHMIRPQWDIPVVSISANNTPYYLSME
EGLGEMDVLGKATREAILKSGKRAVLLASNTLSHWHFHEEPVPPEDMSKEHPQTKIGYEWDMRMIELMRQGRMEEVFQLL
PQFIEEAFAEVKSGAFTWMHAAMQYPNLPAELHGYGTVIGTGNAVVEWNLVKAGLARVA
The query sequence (length=299) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ihg:A | 300 | 299 | 1.0000 | 0.9967 | 1.0000 | 0.0 | 8ihg:C |
2 | 3vsh:D | 304 | 296 | 0.7960 | 0.7829 | 0.8041 | 0.0 | 3vsh:B, 3vsi:B, 3vsi:D, 3vsj:B, 3vsj:D |
3 | 7txy:F | 293 | 286 | 0.5585 | 0.5700 | 0.5839 | 1.68e-122 | 7txy:B, 7txy:D, 7txy:H |
4 | 8in2:A | 263 | 114 | 0.1070 | 0.1217 | 0.2807 | 1.2 | 8in2:B |
5 | 5hee:A | 262 | 79 | 0.0736 | 0.0840 | 0.2785 | 2.6 | 5hee:B |
6 | 8f4v:A | 264 | 38 | 0.0401 | 0.0455 | 0.3158 | 3.5 | 8f4v:E, 8f4v:B, 8f4v:C, 8f4v:D |
7 | 4rkk:A | 317 | 93 | 0.0836 | 0.0789 | 0.2688 | 3.8 | 4rkk:C |
8 | 7e7m:C | 284 | 18 | 0.0301 | 0.0317 | 0.5000 | 6.6 | 7e7m:A, 7e7m:B, 7e7m:D |
9 | 3fcr:A | 458 | 33 | 0.0334 | 0.0218 | 0.3030 | 8.0 |