BioLiP

>protein
NEVAVSYSKSLKAAEMDSLQLPVDADGYITIFDGKTFNGWRGYGKDRVPSKWTIEDGCIKFNGSGGGEAQDGDGGDLIFA
HKFKNFELEMEWKVSKGGNSGIFYLAQEVTSKDKDGNDVLEPIYISAPEYQVLDNDNHPDAKLGKDNNRQSASLYDMIPA
VPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTDLLQASKFSQDKWPLAFELLNNCGGENHEGFIGMQDH
GDDVWFRNIRVKVLD

The query sequence (length=255) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8tde:A	256	255	1.0000	0.9961	1.0000	0.0	8rr2:A, 8rr2:B
2	8v31:C	251	252	0.7725	0.7849	0.7817	9.46e-148	8v31:A
3	4qhz:C	240	250	0.2588	0.2750	0.2640	1.24e-06	4qhz:A, 4qhz:B, 4qhz:D
4	8e6v:A	707	43	0.0549	0.0198	0.3256	0.99
5	6puu:A	1309	43	0.0549	0.0107	0.3256	1.1	8e6t:A, 8e6t:B, 8e6t:C, 8e6t:D, 6pur:A, 6pur:B, 6pur:C, 6pur:D, 6pus:A, 6pus:C, 6pus:D, 6pus:B, 6puu:B, 6puu:C, 6puu:D
6	8e6q:A	1348	43	0.0549	0.0104	0.3256	1.1	8e6q:B, 8e6q:C, 8e6q:D, 8e6r:A, 8e6r:B, 8e6r:C, 8e6r:D, 8e6s:A, 8e6s:B, 8e6s:C, 8e6s:D, 8e6u:A, 8e6u:B, 8e6u:C, 8e6u:D, 6mj2:A, 6mj2:B, 6mj2:C, 6mj2:D
7	8yb6:G	377	47	0.0588	0.0398	0.3191	1.9	8yb6:D, 8yb6:E, 8yb6:F, 8yb6:H, 8yha:E, 8yha:F, 8yha:G, 8yha:H
8	8yha:D	355	47	0.0588	0.0423	0.3191	2.4
9	2o36:A	654	72	0.0706	0.0275	0.2500	3.6	1s4b:P
10	5gsm:A	786	26	0.0392	0.0127	0.3846	6.7	5gsm:B
11	7zm7:B	456	37	0.0549	0.0307	0.3784	9.8	7zmb:B, 7zmg:B

[Back]