NCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDGQAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPE
DEEKNYWNYIKFKKNEFRKFFFMKKQQK
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7lma:H | 199 | 108 | 1.0000 | 0.5427 | 1.0000 | 9.65e-77 | 6d6v:H, 4erd:A, 4erd:B, 7lmb:H, 7uy5:H, 7uy6:H |
2 | 8gap:H | 384 | 120 | 1.0000 | 0.2812 | 0.9000 | 9.61e-72 | |
3 | 7dva:A | 523 | 52 | 0.1389 | 0.0287 | 0.2885 | 1.1 | 7dva:B, 7dvb:A, 7dvb:B, 7dvb:C, 7dvb:D |
4 | 6f4v:A | 341 | 34 | 0.1204 | 0.0381 | 0.3824 | 1.5 | |
5 | 3cux:A | 501 | 24 | 0.1111 | 0.0240 | 0.5000 | 2.5 | |
6 | 2axr:A | 479 | 44 | 0.1111 | 0.0251 | 0.2727 | 4.5 | 3hsu:A, 1zr6:A |
7 | 8jij:A | 411 | 73 | 0.2037 | 0.0535 | 0.3014 | 5.3 | 8jik:A |
8 | 6y88:B | 265 | 82 | 0.1574 | 0.0642 | 0.2073 | 7.5 | 6y88:A, 6y88:C, 6y88:D, 6y88:E, 6y88:F, 6y88:G, 6y88:H |
9 | 6skf:BE | 255 | 36 | 0.1111 | 0.0471 | 0.3333 | 7.9 | 6skg:BE, 6th6:BE |