NACHVPGDQIFLVSNSFTRRLLTRTDHCPKCDRLSTFRFMSVSGMVGRMPYKPVDTPGPSYATLYWRKQRSGKIASQPLN
EVCNK
The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:BG | 85 | 85 | 1.0000 | 1.0000 | 1.0000 | 1.53e-61 | 7am2:BG, 7ane:BG |
2 | 7aoi:Bh | 91 | 74 | 0.5882 | 0.5495 | 0.6757 | 1.52e-34 | 6hiv:Bh, 6hix:Bh, 6yxy:Bh |
3 | 4s3q:A | 682 | 51 | 0.1882 | 0.0235 | 0.3137 | 0.59 | 4s3r:A |
4 | 6jtk:B | 346 | 40 | 0.1882 | 0.0462 | 0.4000 | 0.71 | 6jtk:A, 6jtk:C, 6jtk:F, 6jtk:D, 6jtk:E |
5 | 3w2z:A | 178 | 32 | 0.1412 | 0.0674 | 0.3750 | 4.4 | 5zoh:A |
6 | 6su2:A | 498 | 56 | 0.2000 | 0.0341 | 0.3036 | 9.9 | 6su2:B, 6su2:C, 6su2:D |