MYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTLLSPDERTAMRQGVISQRTAWIREQAKYYLEAG
The query sequence (length=285) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5cb0:A |
290 |
289 |
0.9404 |
0.9241 |
0.9273 |
0.0 |
5cb0:B, 4r2j:A |
2 |
4wy2:A |
308 |
298 |
0.7018 |
0.6494 |
0.6711 |
2.38e-145 |
|
3 |
4r2l:A |
142 |
115 |
0.0982 |
0.1972 |
0.2435 |
1.57e-04 |
4r2l:B, 4r2m:A, 4r2m:B |
4 |
3fdx:A |
127 |
83 |
0.0947 |
0.2126 |
0.3253 |
1.87e-04 |
3fdx:B, 3fh0:A, 3fh0:B |
5 |
3s3t:A |
145 |
73 |
0.0772 |
0.1517 |
0.3014 |
0.016 |
3s3t:B, 3s3t:C, 3s3t:D, 3s3t:E, 3s3t:F, 3s3t:G, 3s3t:H |
6 |
3tnj:A |
130 |
46 |
0.0561 |
0.1231 |
0.3478 |
0.11 |
|
7 |
2z09:A |
124 |
80 |
0.0702 |
0.1613 |
0.2500 |
0.12 |
2z08:A |
8 |
2z09:A |
124 |
54 |
0.0526 |
0.1210 |
0.2778 |
3.4 |
2z08:A |
9 |
5nfn:B |
318 |
82 |
0.0842 |
0.0755 |
0.2927 |
1.2 |
5nfn:A, 5nfn:C, 5nfn:D, 5nfo:A, 5nfo:B |
10 |
6zu5:LP0 |
153 |
63 |
0.0561 |
0.1046 |
0.2540 |
4.0 |
|
11 |
6hzn:A |
743 |
43 |
0.0526 |
0.0202 |
0.3488 |
5.9 |
|
12 |
3ibj:A |
661 |
96 |
0.0877 |
0.0378 |
0.2604 |
6.4 |
4c1i:A, 4c1i:B, 4c1i:C, 4c1i:D, 6c7d:A, 6c7d:B, 6c7d:C, 6c7d:D, 6c7e:A, 6c7e:B, 6c7e:C, 6c7e:D, 6c7f:A, 6c7f:B, 6c7f:C, 6c7g:A, 6c7g:B, 6c7g:C, 6c7g:D, 6c7i:A, 6c7i:B, 6c7i:C, 6c7i:D, 6c7j:A, 6c7j:B, 6c7j:C, 6c7j:D, 4d08:A, 4d08:B, 4d08:C, 4d08:D, 4d09:A, 4d09:B, 4d09:C, 4d09:D, 6ezf:A, 4htx:A, 4htx:B, 4htx:C, 4htx:D, 4htz:A, 4htz:B, 4htz:C, 4htz:D, 3itm:A, 3itm:B, 3itm:C, 3itm:D, 3itu:A, 3itu:B, 3itu:C, 3itu:D, 4jib:A, 4jib:B, 4jib:C, 4jib:D, 1mc0:A, 5tz3:A, 5tz3:B, 5tz3:C, 5tz3:D, 5tza:A, 5tza:B, 5tza:C, 5tza:D, 5tzc:A, 5tzc:B, 5tzc:C, 5tzc:D, 5tzh:A, 5tzh:B, 5tzh:C, 5tzh:D, 5tzw:A, 5tzw:B, 5tzw:C, 5tzw:D, 5tzx:A, 5tzx:B, 5tzx:C, 5tzx:D, 5tzz:A, 5tzz:B, 5tzz:C, 5tzz:D, 5u00:A, 5u00:B, 5u00:C, 5u00:D, 5u7d:A, 5u7d:B, 5u7d:C, 5u7i:A, 5u7i:B, 5u7i:C, 5u7i:D, 5u7j:A, 5u7j:B, 5u7j:C, 5u7j:D, 5u7k:A, 5u7k:B, 5u7k:C, 5u7k:D, 5u7l:A, 5u7l:B, 5u7l:C, 5vp0:A, 5vp0:B, 5vp0:C, 5vp1:A, 5vp1:B, 5vp1:C, 5xkm:A, 5xkm:B, 5xkm:C, 5xkm:D, 5xkm:E, 5xkm:F, 1z1l:A, 6znd:A, 6znd:B, 6zqz:A, 6zqz:B, 6zqz:C, 6zqz:D |
13 |
3ibj:B |
643 |
96 |
0.0877 |
0.0389 |
0.2604 |
6.7 |
|
14 |
2j07:A |
419 |
68 |
0.0702 |
0.0477 |
0.2941 |
7.0 |
1iqr:A, 1iqu:A, 2j08:A, 2j09:A |
15 |
5e25:A |
290 |
40 |
0.0526 |
0.0517 |
0.3750 |
8.0 |
5cm0:A, 5cm0:B, 5cm0:C, 5e25:B, 5e25:C |