MVCKCDCKNQNCSCNTGTKDCDCSDAKCCEQYCCPTASEKKCCKSGCAGGCKCANCECAQAAH
The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8ap5:A | 63 | 63 | 1.0000 | 1.0000 | 1.0000 | 1.79e-36 | |
| 2 | 8aq9:A | 44 | 31 | 0.3492 | 0.5000 | 0.7097 | 2.43e-07 |
umich.edu