MTYKLILNGKTHKGELTTEAVDAATAEKHFKQHANDLGVDGEWTYDDATKTFTVTE
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6nl8:A | 56 | 56 | 1.0000 | 1.0000 | 1.0000 | 1.01e-35 | 6nla:A |
2 | 2i2y:A | 150 | 56 | 0.8929 | 0.3333 | 0.8929 | 4.47e-29 | 9asq:H, 5bmg:A, 5bmg:B, 5bmg:H, 5bmg:D, 5bmg:E, 5bmg:F, 5bmg:G, 5bmh:A, 3v3x:C, 3v3x:D |
3 | 5o94:A | 56 | 56 | 0.7679 | 0.7679 | 0.7679 | 2.01e-24 | 5ofs:A, 5ofs:B, 5ofs:C, 5ofs:D |
4 | 7rxc:B | 439 | 55 | 0.8036 | 0.1025 | 0.8182 | 9.22e-24 | 7rxd:B |
5 | 6nl6:B | 56 | 56 | 0.7679 | 0.7679 | 0.7679 | 1.10e-17 | 6nl6:C, 6nl6:D, 6nl7:B |
6 | 5lde:B | 225 | 52 | 0.6964 | 0.1733 | 0.7500 | 1.53e-16 | 5lde:A |
7 | 8jxr:C | 341 | 55 | 0.5179 | 0.0850 | 0.5273 | 1.26e-07 | |
8 | 5aob:A | 278 | 32 | 0.2143 | 0.0432 | 0.3750 | 0.65 | 5aoc:A, 7bfr:A |
9 | 2q4a:B | 322 | 21 | 0.1964 | 0.0342 | 0.5238 | 1.7 | 2q4a:A, 1y0z:A, 1y0z:B |
10 | 2gh9:A | 378 | 36 | 0.2143 | 0.0317 | 0.3333 | 2.6 | |
11 | 7nrr:AAA | 329 | 32 | 0.2500 | 0.0426 | 0.4375 | 4.4 | 7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B |
12 | 6ffl:A | 383 | 46 | 0.2143 | 0.0313 | 0.2609 | 7.8 | |
13 | 4l9o:A | 330 | 14 | 0.1607 | 0.0273 | 0.6429 | 8.5 | 4l9o:B |
14 | 8khn:A | 287 | 19 | 0.1786 | 0.0348 | 0.5263 | 9.3 | 8kho:A |
15 | 7mq8:LW | 453 | 20 | 0.1786 | 0.0221 | 0.5000 | 9.7 | 7mq9:LW |
16 | 7mqa:LW | 452 | 20 | 0.1786 | 0.0221 | 0.5000 | 10.0 |