BioLiP

>protein
MTPSLMNFFYSLLAGLLIIVVPATVGLIFISQKDKIIRRS

The query sequence (length=40) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wql:XD	40	40	1.0000	1.0000	1.0000	9.82e-23	8wql:XE, 8wql:X1, 8wql:x1, 8wql:xD, 8wql:xE
2	7n8o:X	38	38	0.6750	0.7105	0.7105	2.66e-14	7n8o:x, 7rcv:X, 7rcv:x, 8tow:X, 8tow:x, 6wj6:X
3	8wb4:X	39	38	0.4500	0.4615	0.4737	6.59e-07	8wb4:x, 8xr6:X, 8xr6:x
4	8xlp:x	36	36	0.4250	0.4722	0.4722	2.29e-06	8xlp:X
5	7vd5:X	37	38	0.4750	0.5135	0.5000	6.85e-05	6jlu:X, 6jlu:x, 7vd5:x
6	4il6:X	40	38	0.4500	0.4500	0.4737	0.006	3a0b:X, 3a0b:x, 5b5e:X, 5b5e:x, 5b66:X, 5b66:x, 7d1t:X, 7d1t:x, 7d1u:X, 7d1u:x, 6dhe:X, 6dhf:X, 6dhh:X, 6dho:X, 6dhp:X, 5e79:X, 5e7c:X, 5e7c:x, 7eda:X, 8ez5:X, 8ez5:x, 8f4d:X, 8f4d:x, 8f4e:X, 8f4f:X, 8f4f:x, 8f4g:X, 8f4h:X, 8f4i:X, 8f4i:x, 8f4j:X, 8f4j:x, 8f4k:X, 8gn0:x, 8gn1:x, 8gn2:x, 5h2f:X, 5h2f:x, 4il6:x, 8ir5:X, 8ir6:x, 8ir8:x, 8ira:X, 8irc:x, 8ird:x, 8ire:x, 8irf:x, 8iri:X, 8iri:x, 4ixr:X, 6jlj:X, 6jlj:x, 6jlk:X, 6jlk:x, 6jll:x, 6jlm:x, 6jln:X, 6jln:x, 6jlp:X, 6jlp:x, 5kaf:X, 5kai:X, 5kai:x, 3kzi:X, 5mx2:x, 4pbu:X, 4pbu:x, 7rf1:x, 7rf2:X, 7rf3:X, 7rf4:X, 7rf4:x, 7rf5:X, 7rf6:X, 7rf7:X, 7rf8:X, 7rf8:x, 4rvy:X, 4rvy:x, 5tis:x, 4ub6:X, 4ub8:X, 5v2c:X, 5v2c:x, 4v62:AX, 4v62:BX, 6w1o:X, 6w1o:x, 6w1p:X, 6w1r:X, 6w1t:X, 6w1u:X, 6w1v:X, 6w1v:x, 3wu2:X, 3wu2:x, 7yq2:X, 7yq2:x, 7yq7:x, 5zzn:x
7	7pi0:X	30	19	0.2500	0.3333	0.5263	0.36	7pi0:x, 7pi5:X, 7pi5:x, 7pin:X, 7pin:X1, 7pin:x1, 7piw:X, 7piw:x, 7piw:x1, 7pnk:X, 7pnk:x
8	6kaf:x	35	19	0.2500	0.2857	0.5263	0.79	6kaf:X, 8kde:X, 8zee:X
9	4oxi:A	526	24	0.2500	0.0190	0.4167	4.3
10	5xnl:X	39	39	0.3750	0.3846	0.3846	5.3	5xnl:x

[Back]