Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MTPSLANFLWSLVLGAAIVLIPATVGLIFISQKDK

The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7n8o:X 38 35 1.0000 0.9211 1.0000 4.88e-19 7n8o:x, 7rcv:X, 7rcv:x, 8tow:X, 8tow:x, 6wj6:X
2 8wql:XD 40 35 0.7143 0.6250 0.7143 5.77e-13 8wql:XE, 8wql:X1, 8wql:x1, 8wql:xD, 8wql:xE
3 8wb4:X 39 35 0.4857 0.4359 0.4857 1.61e-05 8wb4:x, 8xr6:X, 8xr6:x
4 8xlp:x 36 35 0.4571 0.4444 0.4571 1.29e-04 8xlp:X
5 7vd5:X 37 35 0.4571 0.4324 0.4571 0.002 6jlu:X, 6jlu:x, 7vd5:x
6 7pi0:X 30 18 0.3429 0.4000 0.6667 0.11 7pi0:x, 7pi5:X, 7pi5:x, 7pin:X, 7pin:X1, 7pin:x1, 7piw:X, 7piw:x, 7piw:x1, 7pnk:X, 7pnk:x
7 6kaf:x 35 19 0.3143 0.3143 0.5789 0.12 6kaf:X, 8kde:X, 8zee:X
8 5xnl:X 39 19 0.2857 0.2564 0.5263 1.0 5xnl:x
9 7r0h:A 654 23 0.2571 0.0138 0.3913 4.4 3a1c:A, 3a1c:B, 3a1d:A, 3a1d:B, 3a1e:A, 3a1e:B
10 8rqf:A 301 25 0.2286 0.0266 0.3200 9.9 7zyi:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218