MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSETQRTKFLNTVAIPDSVQILVGYMT
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jj4:B | 76 | 75 | 1.0000 | 0.9737 | 0.9867 | 2.17e-49 | 1jj4:A |
2 | 2ayb:A | 87 | 80 | 0.5405 | 0.4598 | 0.5000 | 5.66e-22 | 2ayb:B, 2ayg:A, 2ayg:B |
3 | 2bop:A | 85 | 71 | 0.2703 | 0.2353 | 0.2817 | 3.48e-05 | |
4 | 4xdy:A | 331 | 26 | 0.1486 | 0.0332 | 0.4231 | 0.26 | 4xdy:B |
5 | 8him:B | 971 | 21 | 0.1216 | 0.0093 | 0.4286 | 3.4 | |
6 | 4n2z:A | 318 | 14 | 0.1081 | 0.0252 | 0.5714 | 5.3 | |
7 | 6kbn:C | 504 | 30 | 0.1622 | 0.0238 | 0.4000 | 6.0 | 6kbm:A, 6kbn:A |
8 | 7ajt:UA | 834 | 38 | 0.1892 | 0.0168 | 0.3684 | 6.8 | 7d5s:B1, 6ke6:B1, 6lqp:B1, 6lqq:B1, 6lqu:B1, 6nd4:O, 7suk:LO, 5wlc:LO, 6zqa:UA, 6zqb:UA, 6zqc:UA |
9 | 6uke:X | 258 | 47 | 0.1757 | 0.0504 | 0.2766 | 6.9 | 6ukf:X, 6ukg:X, 6ukh:X, 6uki:X, 6uki:Y |
10 | 6lqs:B1 | 806 | 38 | 0.1892 | 0.0174 | 0.3684 | 7.2 | 7aju:UA, 7d4i:B1, 7d5t:B1, 7d63:B1, 6lqr:B1, 6lqt:B1, 6lqv:B1, 6zqd:UA, 6zqe:UA, 6zqf:UA |
11 | 4o4e:A | 246 | 41 | 0.2027 | 0.0610 | 0.3659 | 8.4 | 4o4d:A, 4o4f:A, 8omi:A |
12 | 5fg3:A | 598 | 54 | 0.2027 | 0.0251 | 0.2778 | 9.2 | 5yt0:A |