MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLASFKKNGQIDEQADICESLHDHADELY
RSCLARFGGSKQEKTALNMARFIRSQTLTLLEKLNELAKG
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1yo7:A | 120 | 120 | 1.0000 | 1.0000 | 1.0000 | 4.70e-85 | 1yo7:B |
2 | 1f4n:A | 59 | 55 | 0.3750 | 0.7627 | 0.8182 | 6.16e-27 | 1f4m:A, 1f4m:C, 1f4m:E, 1f4n:B |
3 | 1f4n:A | 59 | 29 | 0.2000 | 0.4068 | 0.8276 | 2.55e-10 | 1f4m:A, 1f4m:C, 1f4m:E, 1f4n:B |
4 | 2vma:A | 122 | 48 | 0.1417 | 0.1393 | 0.3542 | 0.20 | 3c1q:A, 3c1q:B, 2vma:B, 2vmb:A, 2vmb:B |
5 | 6tz6:A | 361 | 18 | 0.0833 | 0.0277 | 0.5556 | 1.5 | 6tz6:D |
6 | 6tz6:A | 361 | 18 | 0.0750 | 0.0249 | 0.5000 | 6.8 | 6tz6:D |
7 | 2wb9:A | 210 | 61 | 0.1500 | 0.0857 | 0.2951 | 4.2 | 2wb9:B, 2wdu:A, 2wdu:B |
8 | 7cb8:A | 394 | 38 | 0.1167 | 0.0355 | 0.3684 | 4.8 | 7cb8:B |
9 | 1jmt:A | 98 | 61 | 0.1500 | 0.1837 | 0.2951 | 5.2 | |
10 | 7chj:B | 226 | 22 | 0.0917 | 0.0487 | 0.5000 | 5.6 | 7chj:A, 6s0p:A, 6s7e:A |
11 | 5kzd:A | 284 | 19 | 0.0750 | 0.0317 | 0.4737 | 6.6 | 5kzd:B, 5kzd:C, 5kzd:D |