MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIA
DIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQE
AVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVR
EVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
The query sequence (length=283) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dua:A | 283 | 283 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2hjp:A |
2 | 5unc:A | 289 | 283 | 0.4452 | 0.4360 | 0.4452 | 4.95e-74 | 5unc:B, 5unc:C, 5unc:D |
3 | 1m1b:A | 291 | 289 | 0.4099 | 0.3986 | 0.4014 | 2.29e-69 | 1m1b:B, 1pym:A, 1pym:B |
4 | 3b8i:A | 284 | 252 | 0.3004 | 0.2993 | 0.3373 | 5.32e-29 | 3b8i:B, 3b8i:C, 3b8i:D, 3b8i:E, 3b8i:F |
5 | 6t4v:C | 277 | 262 | 0.3180 | 0.3249 | 0.3435 | 3.27e-26 | 6t4v:A, 6t4v:B, 6t4v:D, 6t5m:C, 6t5m:A, 6t5m:D, 6t5m:B |
6 | 1mum:A | 289 | 277 | 0.3074 | 0.3010 | 0.3141 | 5.35e-22 | 1o5q:A, 1o5q:B, 1o5q:C, 1o5q:D, 1xg3:A, 1xg3:B, 1xg3:C, 1xg3:D |
7 | 4iqd:A | 290 | 269 | 0.2650 | 0.2586 | 0.2788 | 5.52e-21 | 4iqd:B |
8 | 3fa3:B | 302 | 264 | 0.2792 | 0.2616 | 0.2992 | 2.66e-17 | 3fa3:A, 3fa3:C, 3fa3:D, 3fa3:E, 3fa3:F, 3fa3:G, 3fa3:H, 3fa3:I, 3fa3:J, 3fa3:K, 3fa3:L, 3fa3:M, 3fa3:N, 3fa3:O, 3fa3:P, 3fa4:A, 3fa4:B, 3fa4:C, 3fa4:D, 3fa4:E, 3fa4:F, 3fa4:G, 3fa4:H, 3fa4:I, 3fa4:J, 3fa4:K, 3fa4:L |
9 | 3m0j:A | 297 | 278 | 0.2756 | 0.2626 | 0.2806 | 1.80e-16 | 3lye:A, 3m0k:A |
10 | 1zlp:B | 285 | 162 | 0.2014 | 0.2000 | 0.3519 | 5.02e-14 | 1zlp:A |
11 | 2ze3:A | 275 | 216 | 0.2226 | 0.2291 | 0.2917 | 5.63e-11 | |
12 | 6g1o:A | 486 | 99 | 0.1237 | 0.0720 | 0.3535 | 3.55e-05 | |
13 | 6lrt:A | 423 | 102 | 0.0848 | 0.0567 | 0.2353 | 0.032 | 6lrt:D, 6lrt:G, 6lrt:J, 6lrt:M, 6lrt:P, 6lrt:S, 6lrt:V |
14 | 5e9f:D | 453 | 83 | 0.1060 | 0.0662 | 0.3614 | 0.12 | |
15 | 5e9f:B | 501 | 83 | 0.1060 | 0.0599 | 0.3614 | 0.13 | 5e9f:C, 5e9g:C |
16 | 7rbx:C | 425 | 221 | 0.1696 | 0.1129 | 0.2172 | 0.14 | 7rbx:A, 7rbx:B, 7rbx:D |
17 | 7cmy:C | 417 | 102 | 0.0848 | 0.0576 | 0.2353 | 0.16 | |
18 | 1igw:A | 396 | 161 | 0.1519 | 0.1086 | 0.2671 | 0.64 | |
19 | 6c4a:A | 428 | 168 | 0.1555 | 0.1028 | 0.2619 | 0.89 | 6c4a:B, 6c4a:C, 6c4a:D, 6c4a:E, 6c4a:F, 6c4a:G, 6c4a:H, 6c4c:A, 6c4c:B, 6c4c:C, 6c4c:D, 6c4c:E, 6c4c:F, 6c4c:G, 6c4c:H, 7cp1:A, 7cp1:B, 5dql:A, 5dql:B, 5dql:C, 5dql:D, 1f61:A, 1f61:B, 1f8i:A, 1f8i:B, 1f8i:C, 1f8i:D, 1f8m:A, 1f8m:B, 1f8m:C, 1f8m:D, 7rb1:A, 7rb1:B, 7rb1:C, 7rb1:D, 6vb9:A, 6vb9:B, 6vb9:C, 6vb9:D, 6wsi:A, 6wsi:B, 6wsi:C, 6wsi:D, 6xpp:A, 6xpp:B, 6xpp:C, 6xpp:D |
20 | 6gau:A | 1088 | 149 | 0.1237 | 0.0322 | 0.2349 | 1.2 | 5bs8:A, 5bs8:B, 5bs8:C, 5bs8:D, 5bta:A, 5bta:B, 5bta:C, 5bta:D, 5btc:A, 5btc:B, 5btc:C, 5btc:D, 5btd:A, 5btd:B, 5btd:C, 5btd:D, 5btf:A, 5btf:B, 5btf:C, 5btf:D, 5btg:A, 5btg:B, 5btg:C, 5btg:D, 5bti:A, 5bti:B, 5bti:C, 5bti:D, 5btl:A, 5btl:B, 5btl:C, 5btl:D, 5btn:A, 5btn:B, 5btn:C, 5btn:D, 9foy:A, 9foy:B, 6gau:B, 7ugw:A, 7ugw:B, 7ugw:C, 7ugw:D |
21 | 1igw:C | 416 | 37 | 0.0459 | 0.0312 | 0.3514 | 1.3 | 1igw:B, 1igw:D |
22 | 8z1r:B | 516 | 79 | 0.0813 | 0.0446 | 0.2911 | 1.5 | 8z1r:A |
23 | 6edz:C | 723 | 96 | 0.0954 | 0.0373 | 0.2812 | 2.1 | |
24 | 3lee:F | 262 | 73 | 0.0707 | 0.0763 | 0.2740 | 2.3 | |
25 | 8adl:A | 633 | 56 | 0.0777 | 0.0348 | 0.3929 | 2.8 | 8adl:I |
26 | 8s8f:m | 77 | 19 | 0.0353 | 0.1299 | 0.5263 | 3.1 | 8s8i:m |
27 | 5e9h:A | 518 | 89 | 0.1025 | 0.0560 | 0.3258 | 3.2 | |
28 | 4lsb:B | 278 | 238 | 0.2473 | 0.2518 | 0.2941 | 5.3 | 4lsb:A |
29 | 5e9g:B | 525 | 89 | 0.1060 | 0.0571 | 0.3371 | 5.6 | 5e9f:A, 5e9g:A |
30 | 5e9g:D | 486 | 89 | 0.1060 | 0.0617 | 0.3371 | 5.6 | |
31 | 4rle:A | 116 | 25 | 0.0424 | 0.1034 | 0.4800 | 5.9 | |
32 | 3szy:A | 413 | 125 | 0.1237 | 0.0847 | 0.2800 | 6.2 | 3szz:A, 3t00:A, 3t01:A, 3t02:A |
33 | 4zfv:A | 436 | 30 | 0.0495 | 0.0321 | 0.4667 | 6.9 | 5bsb:A, 5bvc:A, 5tkr:A, 4yh5:A, 4yh5:B, 4zfv:B, 4zlu:A, 4zlu:B |
34 | 6gsm:m | 96 | 19 | 0.0353 | 0.1042 | 0.5263 | 7.1 | 8cah:m, 6gsn:m, 3j80:j, 3j81:m, 3jam:j, 3jap:m, 4uer:F, 6zce:m |
35 | 6ywe:U | 138 | 78 | 0.0777 | 0.1594 | 0.2821 | 7.6 | 6yws:U, 6ywv:U, 6ywx:U, 6ywy:U |
36 | 6mgr:C | 369 | 139 | 0.1272 | 0.0976 | 0.2590 | 7.7 | 6mgr:A, 6mgr:B, 6mgr:D, 4mz1:A, 4mz1:B, 4mz1:C, 4mz8:A, 4mz8:B, 4mz8:C, 4mz8:D, 4r7j:A, 5uqf:A, 5uqf:B, 5uqf:C, 5uqg:A, 5uqg:B, 5uqg:H, 5uqg:C, 5uqg:G, 5uqg:D, 5uqg:E, 5uqg:F, 5uqh:A, 5uqh:B, 5uqh:C, 5uqh:D, 5uqh:E, 5uqh:F, 5uqh:G, 5uqh:H, 5urq:A, 5urq:D, 5urq:B, 5urq:C, 5urq:E, 5urq:H, 5urq:F, 5urq:G |
37 | 2d7d:A | 621 | 127 | 0.1201 | 0.0548 | 0.2677 | 9.4 | 2nmv:A, 3v4r:B, 3v4r:A |