BioLiP

>protein
MTELKQADQIRTWVQSVLTGHDWLHISRVADLAVYIGEKENADLFIVETAALVHDLIDVKLPDTIRLSVSEVYNQLVTFG
IGKEDADRVIHIITKMSPLSIEGKVVQDADRLDAIGAVGIARAFMFAGAKGHGLYGDDQSAYAHFFHKLLRLIDMMNTDT
ARELAEERHEFMLQYIRQLEKDIPGIDA

The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5dqw:A	188	188	1.0000	1.0000	1.0000	5.76e-138	5dqw:B
2	2qgs:A	209	194	0.4255	0.3828	0.4124	5.22e-45	2qgs:B
3	3djb:A	188	189	0.4202	0.4202	0.4180	1.77e-41	3djb:B
4	3b57:A	180	179	0.3830	0.4000	0.4022	8.11e-38
5	2pq7:A	174	168	0.2713	0.2931	0.3036	5.72e-13
6	8d33:A	974	49	0.0957	0.0185	0.3673	0.94	8d37:A, 8d3r:A, 8d42:A, 8udl:A, 8v54:A
7	2c20:A	329	110	0.1330	0.0760	0.2273	3.8	2c20:B, 2c20:C, 2c20:D, 2c20:E, 2c20:F
8	6xfa:A	406	16	0.0479	0.0222	0.5625	6.4	6xfa:B, 6xfa:C, 6xfa:D, 6xfa:E, 6xfa:F, 6xfa:G, 6xfa:H, 6xfa:I, 6xfa:J
9	8auh:A	365	38	0.0745	0.0384	0.3684	7.5	8a8i:B, 8a8i:D, 8au8:A, 8au8:B, 8au9:B, 8au9:A, 8auf:A, 8auf:B, 8aug:A, 8aug:B, 8auh:B, 8aui:A, 8aui:B, 5cpl:A, 5cpl:B, 5cpm:A, 5cpm:B, 5cpn:A, 5cpn:B, 5cpo:A, 5cpo:B, 2h8x:A, 2h8z:A, 2h90:A, 3l5l:A, 3l5m:A, 3l65:A, 3l66:A, 3l67:A, 3l68:A, 5lni:A, 5lnj:A, 3n14:A, 3n19:B, 3n19:D, 5n6q:A, 5n6q:B, 4uth:A, 4uti:A, 4utj:A, 4utk:A, 4utl:A, 4utm:A
10	5x4j:A	471	104	0.1543	0.0616	0.2788	9.3	5x4h:A, 5x4i:A, 5x4k:A

[Back]