Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MSTVTTINLEDIKEICHTTIRLGGKPESGEAAELPIFLGSSVEFEDELYDADGTQIGTAKGTSVIFAEADGTVMQIVSAF
DDYTDGGRVTWSGAYTMFPTDEPKSVPAQGVSGRYRGLSGTRTLQLLERPDPGTSLIRSSLVLNG

The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7x81:A 145 145 0.9724 0.9724 0.9724 4.03e-101 7x81:B, 7x86:A, 7x86:B, 7x86:C, 7x86:D
2 7pxo:AAA 136 93 0.2276 0.2426 0.3548 5.40e-05 7pxo:BBB, 7pxo:DDD
3 8of7:A 139 105 0.2000 0.2086 0.2762 0.002
4 8of7:B 119 92 0.1931 0.2353 0.3043 0.008
5 5bu3:A 181 90 0.1724 0.1381 0.2778 0.11 5bu3:B, 5bu3:C, 5bu3:D, 7dvk:A, 7dvk:B, 7dvk:C, 7dvk:D
6 8ton:A 224 84 0.1586 0.1027 0.2738 0.78
7 5f1c:B 355 47 0.1034 0.0423 0.3191 2.5 5f1c:A, 5f1c:C
8 5jca:L 471 97 0.1862 0.0573 0.2784 6.9 5jfc:L

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218