MSSPILGYTQGKMNQQRVGQDNRLYVRAGAAIDALGSASDLLVGGNGGSLSSVDLSGVKSITATSGDFQYGGQQLVALTF
TYQDGRQQTVGSKAYVTNAHEDRFDLPDAAKITQLKIWADDWLVKGVQFDLN
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1xez:A | 663 | 131 | 0.9924 | 0.1976 | 1.0000 | 4.75e-87 | 4gx7:A, 4gx7:B, 4gx7:D, 4gx7:C, 4gx7:E, 4gx7:F, 8jc7:A, 8jc7:B, 8jc7:C, 8jc7:D, 8jc7:E, 8jc7:F, 8jc7:G |
2 | 5v6f:A | 137 | 135 | 0.4015 | 0.3869 | 0.3926 | 5.90e-30 | 5v6k:A |
3 | 6mlt:A | 603 | 120 | 0.2955 | 0.0647 | 0.3250 | 2.59e-18 | |
4 | 8ag6:A | 896 | 57 | 0.1439 | 0.0212 | 0.3333 | 2.2 | 2o8b:A, 2o8c:A, 2o8d:A, 2o8e:A, 2o8f:A, 8olx:A, 8om9:A, 8oma:A, 8omq:A, 3thw:A, 3thx:A, 3thy:A, 3thz:A |
5 | 1l3i:A | 186 | 45 | 0.1212 | 0.0860 | 0.3556 | 2.8 | 1l3i:B, 1l3i:C, 1l3i:D, 1l3i:E, 1l3i:F |
6 | 4leb:A | 299 | 90 | 0.1970 | 0.0870 | 0.2889 | 2.9 | |
7 | 4hlu:A | 265 | 88 | 0.1970 | 0.0981 | 0.2955 | 6.4 | 4hlu:B, 4zir:A |
8 | 8gy9:A | 249 | 31 | 0.1136 | 0.0602 | 0.4839 | 6.6 | 8gy9:B, 8gya:A, 8gya:B, 8gyb:A, 8gyb:B, 8gyb:C, 8gyb:D |
9 | 5fx8:A | 563 | 95 | 0.2045 | 0.0480 | 0.2842 | 7.8 | 5fx8:B |
10 | 2h7y:A | 280 | 56 | 0.1288 | 0.0607 | 0.3036 | 7.9 | 9cgl:A, 9cgl:B, 9cgn:A, 9cgn:B, 2h7x:A, 2h7x:B, 2h7y:B, 2hfj:A, 2hfk:A, 2hfk:B |
11 | 2qua:A | 615 | 47 | 0.0909 | 0.0195 | 0.2553 | 8.7 | 2qub:A, 2qub:C, 2qub:E, 2qub:G, 2qub:I, 2qub:K |