MSLAVEAVKDFLLKLQDDICEALEAEDGQATFVEDKWTGGRTRVMVDGAVIEKGGVNFSHVYGCNFEAMGVSLVIHPKNP
HVPTSHANVRLFVAEPVWWFGGGFDLTPYYAVEEDCRDFHQVAQDLCKPFGADVYARFKGWCDEYFFIPYRNEARGIGGL
FFDDLNEWPFEKCFEFVQAVGKGYMDAYIPIVNRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESIL
ISLPPRARWGYNWQPEPGTPEARLTEYFLTKRQWV
The query sequence (length=275) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3dwr:B | 275 | 275 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3dws:B | 304 | 301 | 1.0000 | 0.9046 | 0.9136 | 0.0 | 3dwr:A, 3dws:A |
3 | 6fmr:A | 475 | 72 | 0.0764 | 0.0442 | 0.2917 | 2.4 | 4d2b:A, 4d2d:A, 5d58:A, 5d59:A, 6eia:A, 6fmy:A, 6ghj:A, 5oxl:A, 5oxm:A, 5oxn:A, 5oxo:A, 5oxq:A, 4xnj:A, 6yof:A, 6yog:A |
4 | 5oxp:A | 462 | 72 | 0.0764 | 0.0455 | 0.2917 | 2.6 | 7ac6:A, 4d2c:A, 5d6k:A, 5oxk:A, 4xni:A |
5 | 7oyc:Q1 | 180 | 36 | 0.0509 | 0.0778 | 0.3889 | 3.7 | |
6 | 5gw7:B | 760 | 45 | 0.0582 | 0.0211 | 0.3556 | 4.8 | 5ca3:A, 5ca3:B, 3d3i:A, 3d3i:B, 5gw7:A, 3w7s:A, 3w7s:B, 3w7t:A, 3w7t:B, 3w7u:A, 3w7u:B, 3w7w:A, 3w7w:B, 3w7x:A, 3w7x:B |
7 | 8wmy:A | 198 | 33 | 0.0327 | 0.0455 | 0.2727 | 4.9 | 8wmy:B |
8 | 6xux:A | 879 | 45 | 0.0582 | 0.0182 | 0.3556 | 5.6 | |
9 | 8imu:A | 523 | 43 | 0.0545 | 0.0287 | 0.3488 | 9.3 | 8imu:B |