MSKRLPPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQSYFLDIKEIFSQL
TEATRKLQARSA
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8y6u:H | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 5.53e-62 | 8y6u:J |
2 | 5y2v:A | 304 | 73 | 0.4130 | 0.1250 | 0.5205 | 6.39e-18 | 5y2v:B, 5y2v:C, 5y2v:D, 5y2w:A |
3 | 4ihs:B | 93 | 63 | 0.2717 | 0.2688 | 0.3968 | 2.98e-09 | 4ihs:A, 4ihs:C, 4ihs:D, 4iht:A, 4iht:B, 4iht:C, 4iht:D |
4 | 8h3v:S | 304 | 80 | 0.3587 | 0.1086 | 0.4125 | 1.40e-07 | 8h3v:T, 8h3v:U, 8h3v:V |
5 | 9f14:A | 324 | 69 | 0.2174 | 0.0617 | 0.2899 | 9.97e-06 | 9f14:B, 9fdd:A, 9fdd:B, 9fdd:C, 9fdd:D, 9fdd:E, 9fdd:F, 9fdd:G, 9fdd:H, 4lq2:A, 4lq5:A, 4m4g:A |
6 | 6g4r:B | 322 | 62 | 0.2283 | 0.0652 | 0.3387 | 8.06e-05 | 6g1b:J, 6g4r:E |
7 | 3fxr:A | 296 | 58 | 0.2174 | 0.0676 | 0.3448 | 0.049 | 3fxu:A, 3fxu:B, 3n6u:A |
8 | 1br6:A | 268 | 53 | 0.1630 | 0.0560 | 0.2830 | 2.8 | 1br5:A, 5ddz:A, 3ej5:X, 4esi:A, 5gu4:A, 5gu4:B, 3hio:A, 4huo:X, 4hup:X, 4hv3:A, 4hv7:X, 8i7p:A, 1ifs:A, 1ifu:A, 1il3:A, 1il4:A, 1il5:A, 1il9:A, 1j1m:A, 7kc9:D, 7kd0:A, 7kdm:D, 7kdu:A, 4lgr:A, 7mln:A, 7mlo:A, 7mlo:B, 7mlp:A, 7mlt:A, 4mx1:A, 4mx5:X, 1obt:A, 6obg:B, 6ocd:A, 6ocd:C, 2p8n:A, 2pjo:A, 3px8:X, 3px9:X, 4q2v:A, 2r2x:A, 3rti:A, 3rtj:A, 1rzo:A, 1rzo:C, 8t9v:A, 8tab:A, 8tad:A, 6urw:A, 6urx:A, 6ury:A, 7xzs:A, 7xzt:A, 7xzu:A, 7xzw:A, 7y02:A, 7y03:A, 7y05:A, 7y06:A, 7y07:A, 7y08:A, 7y4k:A, 7y4m:A, 4z9k:A |
9 | 1r23:A | 104 | 34 | 0.1413 | 0.1250 | 0.3824 | 3.7 | 1r22:A, 1r22:B, 1r23:B |
10 | 6cdb:A | 97 | 81 | 0.2500 | 0.2371 | 0.2840 | 5.0 | 6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A |
11 | 3icq:T | 949 | 40 | 0.1848 | 0.0179 | 0.4250 | 9.5 | 3icq:U |
12 | 7lyu:B | 371 | 36 | 0.1304 | 0.0323 | 0.3333 | 9.9 | 7lyu:A |