MRSIARRTAVGAALLLVMPVAVWISGWRWQPGEQSWLLKAAFWVTETVTQPWGVITHLILFGWFLWCLRFRIKAAFVLFA
ILAAAILVGQGVKSWIKDKVQEPRPFVIWLEKTHHIPVDEFYTLKRAERGNLVKEQLAEEKNIPQYLRSHWQKETGFAFP
SGHTMFAASWALLAVGLLWPRRRTLTIAILLVWATGVMGSRLLLGMAWPRDLVVATLISWALVAVATWLAQRICGPLTP
The query sequence (length=239) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jwy:A | 259 | 239 | 0.9958 | 0.9189 | 0.9958 | 2.67e-171 | 8bm3:A, 8bm3:B, 8bm3:C, 8bm3:D |
2 | 6fmx:A | 201 | 65 | 0.0879 | 0.1045 | 0.3231 | 1.3 | 5jki:A |
3 | 3a1i:A | 508 | 110 | 0.1130 | 0.0531 | 0.2455 | 1.6 | |
4 | 4mxp:A | 310 | 124 | 0.1381 | 0.1065 | 0.2661 | 2.6 | |
5 | 3nks:A | 465 | 57 | 0.0837 | 0.0430 | 0.3509 | 4.7 | 4ivm:B, 4ivo:B |
6 | 8gth:E | 105 | 45 | 0.0711 | 0.1619 | 0.3778 | 6.1 | 8gth:A, 8gth:B, 8gth:C, 8gth:F, 8gth:D |
7 | 5lqw:Q | 791 | 33 | 0.0502 | 0.0152 | 0.3636 | 8.5 |