BioLiP

>protein
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR

The query sequence (length=200) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ac8:B	202	200	0.9950	0.9851	0.9950	1.95e-145	7ac8:D, 7ac8:F, 3zr4:B, 3zr4:D
2	1ox4:B	538	212	0.3000	0.1115	0.2830	2.88e-23	1jvn:B, 1ox4:A, 1ox5:A, 1ox5:B, 1ox6:B
3	7d54:A	242	168	0.2000	0.1653	0.2381	0.080	7d54:B
4	6und:B	230	82	0.1150	0.1000	0.2805	0.18	8tsn:A, 6und:A, 8vq1:A
5	1i7q:B	192	31	0.0650	0.0677	0.4194	0.50	1i7q:D
6	4yd9:A	1656	43	0.0800	0.0097	0.3721	2.0	4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b
7	2rgo:A	557	59	0.0850	0.0305	0.2881	2.1	2rgh:A
8	7e7o:A	2003	42	0.0700	0.0070	0.3333	3.3	7lkp:A
9	7wtb:B	1147	114	0.1350	0.0235	0.2368	3.5	3bg3:A, 3bg3:B, 3bg3:C, 3bg3:D, 3bg9:A, 3bg9:B, 3bg9:C, 3bg9:D, 8j7o:A, 8j7o:B, 8j7o:C, 8j7o:E, 7wta:C, 7wta:B, 7wta:D, 7wta:A, 7wtb:C, 7wtb:A, 7wtb:D, 7wtc:C, 7wtc:A, 7wtc:B, 7wtc:D, 7wtd:C, 7wtd:D, 7wte:C, 7wte:D
10	8hwl:A	941	114	0.1350	0.0287	0.2368	3.8	8hwl:B, 8hwl:C, 8hwl:E
11	4uop:B	409	39	0.0650	0.0318	0.3333	4.4	4uop:A
12	2ywc:A	475	142	0.1850	0.0779	0.2606	7.6	2ywc:B, 2ywc:C, 2ywc:D
13	3bh4:A	483	28	0.0500	0.0207	0.3571	8.5	3bh4:B, 1e3x:A, 1e3z:A, 1e40:A, 1e43:A
14	4jj0:A	181	36	0.0650	0.0718	0.3611	9.0	4jj0:B, 4jj3:A, 4jj3:B

[Back]