MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYV
VGVALGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDG
EIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSL
The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ac8:B | 202 | 198 | 1.0000 | 0.9802 | 1.0000 | 6.84e-145 | 7ac8:D, 7ac8:F, 3zr4:B, 3zr4:D |
2 | 1ox4:B | 538 | 212 | 0.2980 | 0.1097 | 0.2783 | 5.65e-22 | 1jvn:B, 1ox4:A, 1ox5:A, 1ox5:B, 1ox6:B |
3 | 2oas:A | 427 | 47 | 0.0758 | 0.0351 | 0.3191 | 0.77 | 2oas:B |
4 | 1i7q:B | 192 | 29 | 0.0657 | 0.0677 | 0.4483 | 1.6 | 1i7q:D |
5 | 7d54:A | 242 | 168 | 0.1970 | 0.1612 | 0.2321 | 1.8 | 7d54:B |
6 | 4yd9:A | 1656 | 43 | 0.0808 | 0.0097 | 0.3721 | 2.2 | 4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
7 | 2rgo:A | 557 | 59 | 0.0859 | 0.0305 | 0.2881 | 3.6 | 2rgh:A |
8 | 5j14:A | 450 | 69 | 0.1111 | 0.0489 | 0.3188 | 3.8 | 5j14:B, 5j7z:A |
9 | 4uop:B | 409 | 39 | 0.0657 | 0.0318 | 0.3333 | 4.1 | 4uop:A |
10 | 5x68:B | 354 | 46 | 0.0808 | 0.0452 | 0.3478 | 6.6 | 5x68:A |
11 | 5xrs:G | 321 | 73 | 0.1061 | 0.0654 | 0.2877 | 7.0 | 5xrs:A, 5xrs:C |
12 | 4jj0:A | 181 | 36 | 0.0657 | 0.0718 | 0.3611 | 7.8 | 4jj0:B, 4jj3:A, 4jj3:B |
13 | 3bh4:A | 483 | 28 | 0.0505 | 0.0207 | 0.3571 | 8.8 | 3bh4:B, 1e3x:A, 1e3z:A, 1e40:A, 1e43:A |