BioLiP

>protein
MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE

The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2i2y:A	150	56	0.9643	0.3600	0.9643	3.40e-32	9asq:H, 5bmg:A, 5bmg:B, 5bmg:H, 5bmg:D, 5bmg:E, 5bmg:F, 5bmg:G, 5bmh:A, 3v3x:C, 3v3x:D
2	6nl8:A	56	56	0.8571	0.8571	0.8571	1.25e-27	6nla:A
3	5o94:A	56	56	0.8036	0.8036	0.8036	7.58e-27	5ofs:A, 5ofs:B, 5ofs:C, 5ofs:D
4	7rxc:B	439	54	0.8214	0.1048	0.8519	2.90e-25	7rxd:B
5	5lde:B	225	53	0.7679	0.1911	0.8113	4.58e-20	5lde:A
6	6nl6:B	56	56	0.7500	0.7500	0.7500	1.23e-18	6nl6:C, 6nl6:D, 6nl7:B
7	8jxr:C	341	54	0.5536	0.0909	0.5741	1.19e-09
8	7nrr:AAA	329	32	0.2500	0.0426	0.4375	0.71	7nrr:BBB, 7nsw:AAA, 7nsw:BBB, 7ntd:AAA, 7ntd:BBB, 7nte:A, 7nte:B
9	8khn:A	287	22	0.1964	0.0383	0.5000	0.79	8kho:A
10	8izl:A	2067	27	0.1607	0.0044	0.3333	0.94	8izm:A, 8x01:A, 8yxm:A, 8yxp:A
11	4ald:A	363	30	0.1964	0.0303	0.3667	3.9	6ald:A, 6ald:B, 3dft:A, 3dft:B, 3dft:C, 3dft:D, 3lge:A, 3lge:B, 3lge:C, 3lge:D, 2ot0:A, 2ot0:B, 2ot0:C, 2ot0:D, 2ot1:A, 2ot1:B, 2ot1:C, 2ot1:D, 2quv:A, 2quv:B, 2quv:D, 5tle:A, 5tle:B, 5tle:C, 5tle:D, 5tlh:A, 5tlh:B, 5tlh:C, 5tlh:D, 5tlw:A, 5tlw:B, 5tlw:C, 5tlw:D, 5tlz:A, 5tlz:B, 5tlz:C, 5tlz:D, 3tu9:A, 3tu9:B, 3tu9:C, 3tu9:D, 6xmh:A, 6xmh:B, 6xml:A, 6xml:B, 6xmm:A, 6xmm:B, 6xmo:A, 6xmo:B, 1zai:A, 1zai:B, 1zai:C, 1zai:D, 1zaj:A, 1zaj:B, 1zaj:C, 1zaj:D, 1zal:A, 1zal:B, 1zal:C, 1zal:D
12	6m9g:A	280	37	0.2679	0.0536	0.4054	4.4	6eg7:A, 6eg7:B, 6m9g:B
13	4l9o:A	330	14	0.1607	0.0273	0.6429	6.5	4l9o:B

[Back]