MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHD
LSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 3od2:A | 132 | 131 | 1.0000 | 0.9924 | 1.0000 | 2.02e-93 | 3bkt:A, 3bkt:B, 3bkt:C, 3bkt:D, 2hza:A, 2hza:B, 2hzv:A, 2hzv:B, 2hzv:C, 2hzv:D, 2hzv:E, 2hzv:F, 2hzv:G, 2hzv:H, 3od2:B, 1q5y:A, 1q5y:C, 1q5y:B, 1q5y:D |
| 2 | 3bkf:A | 66 | 83 | 0.5038 | 1.0000 | 0.7952 | 5.07e-40 | |
| 3 | 2bj7:B | 138 | 124 | 0.3130 | 0.2971 | 0.3306 | 9.06e-25 | 2bj1:A, 2bj1:B, 2bj7:A, 2bj8:A, 2bj8:B, 2bj9:A, 2bj9:B |
| 4 | 6mrj:B | 142 | 127 | 0.2901 | 0.2676 | 0.2992 | 5.07e-18 | 2cad:A, 2cad:B, 3lgh:A, 3lgh:B, 3lgh:C, 3lgh:D, 6mrj:A, 6mrj:C, 6mrj:D, 3pht:A, 3pht:B, 3qsi:B, 3qsi:C, 3qsi:D, 3qsi:A, 3qsi:F, 3qsi:G, 3qsi:H, 3qsi:E, 3qsi:I, 2wvf:B, 2y3y:A, 2y3y:B, 2y3y:C, 2y3y:D |
| 5 | 3gxq:B | 54 | 39 | 0.0916 | 0.2222 | 0.3077 | 1.2 | 3gxq:A |
| 6 | 5a60:A | 429 | 31 | 0.0916 | 0.0280 | 0.3871 | 2.5 | 5a61:A |
| 7 | 2w57:A | 131 | 48 | 0.1450 | 0.1450 | 0.3958 | 2.9 | 2w57:B |
| 8 | 1ea4:F | 45 | 23 | 0.0687 | 0.2000 | 0.3913 | 3.0 | 1b01:A, 1b01:B, 1ea4:H, 1ea4:J, 1ea4:K, 1ea4:L, 1ea4:D, 1ea4:E, 1ea4:G, 1ea4:B, 1ea4:A |
| 9 | 7sf2:A | 586 | 47 | 0.1145 | 0.0256 | 0.3191 | 8.8 | 7sf2:B, 7sf2:C, 7sf2:D, 7sf2:E, 7sf2:F |
umich.edu