MQRVHTITAVTEDGESLRFECRSDEDVITAALRQNIFLMSSCREGGCATCKALCSEGDYDLKGCSVQALPPEEEEEGLVL
LCRTYPKTDLEIELPYTH
The query sequence (length=98) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1jq4:A | 98 | 98 | 1.0000 | 1.0000 | 1.0000 | 4.19e-69 | |
2 | 1iue:A | 98 | 90 | 0.3878 | 0.3878 | 0.4222 | 8.89e-14 | 1iue:B |
3 | 1krh:A | 337 | 93 | 0.3571 | 0.1039 | 0.3763 | 1.51e-12 | 1krh:B |
4 | 6iri:A | 107 | 89 | 0.3265 | 0.2991 | 0.3596 | 2.88e-10 | |
5 | 5auk:A | 96 | 89 | 0.3367 | 0.3438 | 0.3708 | 6.31e-10 | 1dox:A, 1doy:A, 2kaj:A, 1off:A, 2pvg:C, 2pvo:D |
6 | 5h57:A | 97 | 95 | 0.3367 | 0.3402 | 0.3474 | 8.62e-10 | 5h57:B, 5h57:C, 5h57:D, 5h57:E, 5h57:F, 5h5j:B |
7 | 6khi:1 | 98 | 88 | 0.3061 | 0.3061 | 0.3409 | 2.13e-09 | 5aui:A, 7fix:R1, 7fix:R2, 7fix:R3, 6jo2:A, 6l7o:R, 1roe:A, 5zf0:P1, 5zf0:P2, 5zf0:P3, 5zf0:P4, 5zf0:P6, 5zf0:P5 |
8 | 1pfd:A | 96 | 89 | 0.3061 | 0.3125 | 0.3371 | 3.85e-09 | |
9 | 4zho:A | 97 | 89 | 0.3367 | 0.3402 | 0.3708 | 4.48e-09 | 4zho:B |
10 | 5ogx:A | 333 | 75 | 0.2551 | 0.0751 | 0.3333 | 4.65e-09 | |
11 | 6yac:N | 97 | 89 | 0.3367 | 0.3402 | 0.3708 | 5.32e-09 | 6yez:N |
12 | 6xtf:D | 96 | 89 | 0.3265 | 0.3333 | 0.3596 | 9.82e-09 | 6xtf:C |
13 | 1a70:A | 97 | 90 | 0.3061 | 0.3093 | 0.3333 | 1.18e-08 | |
14 | 4zhp:A | 98 | 89 | 0.2959 | 0.2959 | 0.3258 | 5.02e-08 | |
15 | 7y5e:NN | 99 | 79 | 0.2857 | 0.2828 | 0.3544 | 6.01e-08 | 7y5e:N2, 7y7a:N7, 7y7a:No |
16 | 7s3d:X | 97 | 71 | 0.2857 | 0.2887 | 0.3944 | 1.01e-07 | 7s3d:W, 7s3d:x |
17 | 3ab5:A | 97 | 82 | 0.2551 | 0.2577 | 0.3049 | 1.60e-07 | 3ab5:B, 3wcq:A |
18 | 4n58:A | 266 | 77 | 0.2755 | 0.1015 | 0.3506 | 3.08e-07 | 4n58:B, 4n59:A, 4n59:B |
19 | 3b2g:A | 98 | 87 | 0.3061 | 0.3061 | 0.3448 | 4.96e-07 | 3b2g:B |
20 | 1czp:A | 98 | 88 | 0.3061 | 0.3061 | 0.3409 | 7.05e-07 | 1czp:B, 1ewy:C, 1fxa:A, 1fxa:B, 1j7a:A, 1j7b:A, 1j7c:A, 1qoa:A, 1qoa:B, 1qob:A, 1qob:B, 1qof:A, 1qof:B, 1qog:A, 1qog:B, 1qt9:A |
21 | 8jc1:A | 267 | 74 | 0.2551 | 0.0936 | 0.3378 | 7.85e-07 | 8jc1:B, 8jc1:C, 8jc1:D |
22 | 6vjv:A | 96 | 86 | 0.2755 | 0.2812 | 0.3140 | 1.42e-06 | 6vjv:B |
23 | 4fxc:A | 98 | 91 | 0.2857 | 0.2857 | 0.3077 | 2.68e-06 | |
24 | 4wqm:A | 326 | 76 | 0.2347 | 0.0706 | 0.3026 | 3.44e-06 | |
25 | 1rfk:B | 97 | 90 | 0.3061 | 0.3093 | 0.3333 | 4.87e-06 | 3p63:A, 3p63:B, 1rfk:A |
26 | 1awd:A | 94 | 88 | 0.2857 | 0.2979 | 0.3182 | 4.91e-06 | |
27 | 4itk:A | 104 | 90 | 0.2959 | 0.2788 | 0.3222 | 2.46e-05 | |
28 | 3zyy:X | 628 | 53 | 0.2347 | 0.0366 | 0.4340 | 3.63e-05 | 4c1n:J, 4c1n:I, 4c1n:K, 4c1n:X, 3zyy:Y |
29 | 1gaq:B | 98 | 89 | 0.2653 | 0.2653 | 0.2921 | 4.28e-05 | 3b2f:A, 3b2f:B, 5h8y:E, 5h8y:F, 5h92:C, 3w5u:B, 3w5u:D, 3w5u:F, 3w5u:H, 3w5v:B, 3w5v:D |
30 | 7akt:A | 107 | 89 | 0.2755 | 0.2523 | 0.3034 | 6.90e-05 | 6kum:A, 6kum:B, 6kv0:A, 6kv0:B, 6lk1:A, 6lk1:B, 2mh7:A, 2n0s:B, 7wzn:G |
31 | 1doi:A | 128 | 80 | 0.2857 | 0.2188 | 0.3500 | 1.38e-04 | |
32 | 3av8:A | 97 | 90 | 0.2959 | 0.2990 | 0.3222 | 3.20e-04 | 3av8:B, 3av8:C, 3av8:D, 1fxi:A, 1fxi:B, 1fxi:C, 1fxi:D |
33 | 1e0z:A | 128 | 87 | 0.3061 | 0.2344 | 0.3448 | 4.86e-04 | 1e10:A |
34 | 7c3b:B | 306 | 75 | 0.2347 | 0.0752 | 0.3067 | 0.001 | |
35 | 1frr:A | 95 | 67 | 0.2449 | 0.2526 | 0.3582 | 0.001 | 1frr:B |
36 | 7c3b:C | 334 | 75 | 0.2347 | 0.0689 | 0.3067 | 0.002 | 7c3a:A, 7c3a:B, 7c3a:C, 7c3b:A |
37 | 1wri:A | 93 | 89 | 0.2857 | 0.3011 | 0.3146 | 0.003 | |
38 | 8c6j:S | 635 | 45 | 0.1531 | 0.0236 | 0.3333 | 0.49 | 7abi:O, 8ch6:X, 6ff4:O, 8i0r:J, 8i0s:J, 8i0t:J, 5mqf:O, 7qtt:X, 6zym:O |
39 | 6laa:A | 753 | 46 | 0.1531 | 0.0199 | 0.3261 | 0.52 | 6gii:A, 6ldl:A |
40 | 2pia:A | 321 | 71 | 0.1939 | 0.0592 | 0.2676 | 0.63 | |
41 | 2b5o:A | 292 | 46 | 0.1735 | 0.0582 | 0.3696 | 2.0 | 2b5o:B |
42 | 1cr6:B | 541 | 24 | 0.1122 | 0.0203 | 0.4583 | 2.5 | 1cr6:A, 1ek1:A, 1ek1:B, 1ek2:A, 1ek2:B |
43 | 6kbh:A | 765 | 58 | 0.1633 | 0.0209 | 0.2759 | 2.6 | |
44 | 3wqm:A | 294 | 78 | 0.2347 | 0.0782 | 0.2949 | 3.1 | 4cmx:A, 4cmx:B, 4kt8:A, 3wqk:A, 3wql:A, 3wql:B, 3wql:C, 3wql:D, 3wqn:A |
45 | 5mza:A | 440 | 25 | 0.1122 | 0.0250 | 0.4400 | 4.5 | |
46 | 4wuu:E | 223 | 44 | 0.1531 | 0.0673 | 0.3409 | 6.1 | |
47 | 9b0e:A | 821 | 78 | 0.2347 | 0.0280 | 0.2949 | 9.1 | 9aym:A, 9aym:B, 9b0e:B, 9b0i:A, 9b0i:B |