MQHASVIAQFVVEEFLPDVAPADVDVDLDLVDNGVIDSLGLLKVIAWLEDRFGIAADDVELSPEHFRSIRSIDAFVVGAT
TPPVEAKLQ
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2my5:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 7.28e-59 | 5wpx:A, 5wpy:A |
2 | 2lki:A | 83 | 41 | 0.1685 | 0.1807 | 0.3659 | 0.011 | |
3 | 9cer:P | 609 | 42 | 0.1685 | 0.0246 | 0.3571 | 0.10 | 9ces:P, 9cet:P |
4 | 4bph:A | 85 | 28 | 0.1011 | 0.1059 | 0.3214 | 2.3 | |
5 | 4qyz:K | 152 | 30 | 0.1348 | 0.0789 | 0.4000 | 2.3 | |
6 | 2koo:A | 81 | 50 | 0.1461 | 0.1605 | 0.2600 | 5.1 | 2kop:A, 2koq:A, 2kor:A, 2kos:A |
7 | 6bxn:A | 294 | 50 | 0.1910 | 0.0578 | 0.3400 | 5.9 | |
8 | 6lbp:A | 460 | 33 | 0.1348 | 0.0261 | 0.3636 | 6.5 | 6lbp:B |
9 | 6c75:A | 378 | 34 | 0.1573 | 0.0370 | 0.4118 | 6.7 | 6c75:B, 6c76:A, 6c7l:A |
10 | 8hfr:xI | 65 | 18 | 0.1124 | 0.1538 | 0.5556 | 8.5 |