MPNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSKKVTPGGFNELKTRLSKFLPKEVT
QYNNKLHSR
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3iwf:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 1.09e-61 | |
2 | 8k3b:A | 281 | 73 | 0.2472 | 0.0783 | 0.3014 | 2.27e-06 | 8ju9:A |
3 | 4ivn:A | 264 | 70 | 0.1910 | 0.0644 | 0.2429 | 5.86e-04 | 4ivn:B |
4 | 6i7s:B | 462 | 36 | 0.1573 | 0.0303 | 0.3889 | 0.26 | 6i7s:A |
5 | 5w7p:A | 396 | 39 | 0.1685 | 0.0379 | 0.3846 | 1.6 | 5w7r:A, 5w7s:A |
6 | 8uhe:K | 593 | 34 | 0.1236 | 0.0185 | 0.3235 | 2.0 | |
7 | 5oet:B | 420 | 51 | 0.1685 | 0.0357 | 0.2941 | 2.6 | |
8 | 8com:D | 93 | 51 | 0.1461 | 0.1398 | 0.2549 | 2.6 | 8com:H |
9 | 3p47:A | 270 | 87 | 0.2472 | 0.0815 | 0.2529 | 4.1 | 3q1x:A |
10 | 1af7:A | 274 | 41 | 0.1573 | 0.0511 | 0.3415 | 4.4 | 1bc5:A |
11 | 3op4:A | 247 | 30 | 0.1461 | 0.0526 | 0.4333 | 5.9 | 4i08:A, 4i08:B, 3op4:B, 3rsh:A, 3rsh:B, 4wk6:A, 4wk6:B, 4wk6:C, 4wk6:D |
12 | 3tzc:A | 224 | 27 | 0.1461 | 0.0580 | 0.4815 | 6.3 | |
13 | 2anl:A | 327 | 49 | 0.2022 | 0.0550 | 0.3673 | 9.5 | 2anl:B |