MNWKEFEVFCVTYLNKTYGNKFAKKGESDSTTSDILFTGNNPFYIEAKMPHSQCGQFVLIPNRAEYKFDYSPKNKSEINP
YTQKIMQFMSENFSEYANLSTKGKIIPLPESVFVNWIKEYYKSKSVKFFITSNGDFIIFPIEHFEHYFNVSCTYRIKKSG
SRHLNSKSLPDFKQALDKKGISYTMRGLELHSDENIHDKRISGDDKDFLIKENNGAYHVKILSNTFNANVIFSISLKNNI
SLFILNEDRKAFEAAISL
The query sequence (length=258) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6uke:X | 258 | 258 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6ukf:X, 6ukg:X, 6ukh:X, 6uki:X, 6uki:Y |
2 | 6qp1:B | 398 | 102 | 0.1085 | 0.0704 | 0.2745 | 0.024 | 6qp1:A, 6qp2:A, 6qp2:B |
3 | 6jmt:D | 350 | 62 | 0.0775 | 0.0571 | 0.3226 | 0.56 | 6jmt:C, 6jmt:E, 6jmt:F, 6jmt:A, 6jmt:B |
4 | 8fjm:A | 251 | 73 | 0.0930 | 0.0956 | 0.3288 | 2.6 | 8fjm:B, 8fjn:A |
5 | 7cr7:A | 354 | 55 | 0.0659 | 0.0480 | 0.3091 | 5.8 | 7cr1:A, 7cr1:B, 7cr1:C, 7cr1:D, 7cr2:B, 7cr2:C, 7cr2:D, 7cr2:A, 7cr4:A, 7cr4:B, 7cr4:D, 7cr4:F, 7cr7:G, 7cr7:B, 7cr7:D, 8ijk:A, 8ijk:C, 8ijk:B, 8ijk:D, 8izy:A, 8izy:B, 8izy:D, 8izy:C, 8j01:G, 8j01:A, 8j01:B, 8j01:D, 8j02:G, 8j02:A, 8j02:B, 8j02:D, 8j03:A, 8j03:D, 8j03:G, 8j03:I, 8j04:A, 8j04:G, 8j04:B, 8j04:D, 8w4u:A, 8w4u:B, 8w4u:D, 8w4u:G |
6 | 7f3t:A | 330 | 33 | 0.0310 | 0.0242 | 0.2424 | 5.9 | 7f3t:B, 7f6v:A, 7f6v:B, 7n0l:A, 7n0l:B, 7n7p:A, 7n7p:B |
7 | 8x43:A | 327 | 55 | 0.0659 | 0.0520 | 0.3091 | 6.1 | 8j00:A, 8j00:B, 8j00:C, 8j00:D, 8x43:G, 8x43:C, 8x43:E |
8 | 2xpi:A | 520 | 47 | 0.0620 | 0.0308 | 0.3404 | 8.3 | 2xpi:D |
9 | 7bl5:8 | 157 | 65 | 0.0736 | 0.1210 | 0.2923 | 8.4 | |
10 | 6hrk:A | 135 | 47 | 0.0543 | 0.1037 | 0.2979 | 8.6 | 6hrk:B, 6hrk:C, 6hrk:D |
11 | 4bxs:V | 1262 | 18 | 0.0349 | 0.0071 | 0.5000 | 8.7 |