MNRKVVDTHVHLLLSKKQRVPDWAAIKRMLDVAKVDELDALCVTEHIEADGYQTLMEGLFVENRLPGGDQHAGRLTYQGV
AIFPGAELELANRTNVGVHTDLEGLLALDRAPGAYTLERLHAVLEQRGRPFKLVAHHIFWPGKTCDDLQALGRYVNAIEV
PAKDLANAQNYVALAETLALDTTGGSDAHTFIQVGACRTAFELPGSVRDCTAQDWISSRQTSHLFTAQSPRLVVMSNIYR
QSLM
The query sequence (length=244) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7rty:A | 244 | 244 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7rty:B |
2 | 4ru5:C | 602 | 132 | 0.1352 | 0.0548 | 0.2500 | 0.11 | 4ru5:A, 4ru5:B |
3 | 7o0c:A | 242 | 36 | 0.0533 | 0.0537 | 0.3611 | 2.3 | 2amy:A, 7o0c:B, 7o1b:A, 7o1b:B, 7o4g:A, 7o4g:B, 7o58:A, 7o58:B, 7o5z:A, 7o5z:B, 2q4r:A |
4 | 8ujm:B | 237 | 18 | 0.0410 | 0.0422 | 0.5556 | 4.2 | 8ujm:A |
5 | 6efx:A | 345 | 43 | 0.0574 | 0.0406 | 0.3256 | 4.9 |