MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHNVPAFVSGKALKDAV
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yew:C | 71 | 70 | 1.0000 | 0.9718 | 0.9857 | 1.71e-42 | 6o6k:B, 6oaj:D, 4yex:C, 4yft:C |
2 | 6oaj:B | 79 | 78 | 0.9855 | 0.8608 | 0.8718 | 8.51e-41 | 6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A |
3 | 6o8q:B | 91 | 89 | 1.0000 | 0.7582 | 0.7753 | 1.36e-39 | 6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B |
4 | 4qju:A | 90 | 89 | 0.5362 | 0.4111 | 0.4157 | 1.21e-16 | 4qju:B |
5 | 1p71:A | 94 | 89 | 0.5072 | 0.3723 | 0.3933 | 4.35e-13 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
6 | 4dky:B | 101 | 51 | 0.3043 | 0.2079 | 0.4118 | 6.16e-09 | |
7 | 8flj:F | 94 | 90 | 0.3333 | 0.2447 | 0.2556 | 5.52e-07 | 8flj:H |
8 | 2iie:A | 204 | 50 | 0.2464 | 0.0833 | 0.3400 | 0.004 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
9 | 8flj:G | 98 | 50 | 0.2174 | 0.1531 | 0.3000 | 0.018 | 8flj:E |
10 | 2np2:A | 102 | 93 | 0.2899 | 0.1961 | 0.2151 | 1.4 | 2np2:B |
11 | 3vm7:A | 470 | 15 | 0.1159 | 0.0170 | 0.5333 | 8.9 | |
12 | 7mqa:NS | 914 | 71 | 0.2754 | 0.0208 | 0.2676 | 9.1 | 6o16:A, 6o16:B |
13 | 6nvo:A | 200 | 36 | 0.1739 | 0.0600 | 0.3333 | 9.4 | 6nvp:A |
14 | 8cpl:C | 499 | 18 | 0.1449 | 0.0200 | 0.5556 | 9.5 | 8cpl:A, 8cpl:B, 8cpl:D, 1lp1:B, 4uox:A, 4uox:B, 4uox:C, 4uox:D, 4uoy:A, 4uoy:B, 4uoy:C, 4uoy:D |