MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHANVPAFVSGKALKDAVK
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yew:C | 71 | 71 | 0.9859 | 0.9859 | 0.9859 | 7.67e-45 | 6o6k:B, 6oaj:D, 4yex:C, 4yft:C |
2 | 6oaj:B | 79 | 79 | 0.9859 | 0.8861 | 0.8861 | 4.14e-42 | 6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A |
3 | 6o8q:B | 91 | 90 | 1.0000 | 0.7802 | 0.7889 | 6.36e-41 | 6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B |
4 | 4qju:A | 90 | 90 | 0.5352 | 0.4222 | 0.4222 | 2.02e-17 | 4qju:B |
5 | 1p71:A | 94 | 89 | 0.4930 | 0.3723 | 0.3933 | 3.78e-13 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
6 | 4dky:B | 101 | 89 | 0.4225 | 0.2970 | 0.3371 | 1.03e-09 | |
7 | 8flj:F | 94 | 90 | 0.3239 | 0.2447 | 0.2556 | 1.25e-06 | 8flj:H |
8 | 2iie:A | 204 | 56 | 0.2535 | 0.0882 | 0.3214 | 0.001 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
9 | 8flj:G | 98 | 50 | 0.2113 | 0.1531 | 0.3000 | 0.017 | 8flj:E |
10 | 3zxu:A | 211 | 48 | 0.1690 | 0.0569 | 0.2500 | 3.2 | 5mu3:A, 5mu3:D, 3zxu:C |
11 | 2p18:A | 283 | 39 | 0.1690 | 0.0424 | 0.3077 | 8.0 | 2p1e:A |