MNKAKIFMNGQSQAVRLPKEFRFSVKEVSVIPLGKGIVLQPLPNSWKDVFQEMAEISSDDIFPEGRKDLPPQKRKYFE
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3zvk:F | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 6.39e-53 | 3zvk:E, 3zvk:G, 3zvk:H |
2 | 6ifm:F | 68 | 50 | 0.2308 | 0.2647 | 0.3600 | 4.92e-06 | 6ifm:H, 6ifm:B, 6ifm:D |
3 | 5l6l:D | 84 | 71 | 0.2821 | 0.2619 | 0.3099 | 3.81e-05 | 5l6l:A, 5l6l:E, 5l6l:H |
4 | 7rzy:1 | 311 | 21 | 0.1282 | 0.0322 | 0.4762 | 1.1 | 7rzy:2, 7rzy:7, 7rzy:3, 7rzy:4, 7rzy:5, 7rzy:6, 7ufi:1, 7ufi:7, 7ufi:2, 7ufi:3, 7ufi:4, 7ufi:5, 7ufi:6, 7ufm:D, 7ufm:I, 7ufm:A, 7ufm:B, 7ufm:C, 7ufm:E, 7ufm:F, 7ufm:G, 7ufm:H, 7ufm:J, 7ufm:K, 7ufm:L, 7ufm:M, 7ufm:N |
5 | 5lnk:M | 459 | 16 | 0.1026 | 0.0174 | 0.5000 | 1.5 | 8q0a:M, 8q0f:M, 8q0m:M, 8q0o:M, 8q1y:M, 8q25:M, 8q45:M, 8q48:M, 8q49:M, 8q4a:M, 7qso:M, 7r4f:M, 7r4g:M, 6zkm:M, 6zkn:M, 6zku:M, 6zkv:M |
6 | 2gk1:I | 440 | 45 | 0.1923 | 0.0341 | 0.3333 | 2.9 | 2gk1:J, 2gk1:K, 2gk1:L |
7 | 2d40:A | 289 | 59 | 0.1923 | 0.0519 | 0.2542 | 6.3 | 2d40:B, 2d40:C, 2d40:D |
8 | 6q8o:H | 353 | 47 | 0.1923 | 0.0425 | 0.3191 | 6.6 | 6q8o:Q |