MNDIVASTQLPNTIKTITNDLRKLGLKKGMTVIVHSSLSSIGWISGGAVAVVEALMEVITEEGTIIMPTQSSDLSDPKHW
SRPPVPEEWWQIIRDNVPAFEPHITPTRAMGKVVECFRTYPNVVRSNHPLGSFAAWGRHAEEITVNQSLSMSLGEESPLR
KIYDLDGYILLIGVGYDSNTSVHLSEVRSGACELIKVGAPIIENGERVWKEFVDMDYDSDKFVEIGVEFEQKGTVTMGKI
GNAKCRLMKQRDIVDFGTEWFRKK
The query sequence (length=264) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kzl:A | 266 | 263 | 0.9924 | 0.9850 | 0.9962 | 0.0 | 3ijw:A, 3ijw:B, 3kzl:D, 3kzl:C, 3kzl:B, 3n0m:A, 3n0m:B, 3n0s:A, 3n0s:D, 3n0s:C, 3n0s:B, 3slb:A, 3slb:D, 3slb:C, 3slb:B, 3slf:A, 3slf:B |
2 | 2nyg:A | 270 | 262 | 0.5341 | 0.5222 | 0.5382 | 2.47e-105 | 2nyg:B, 2nyg:C, 2nyg:D, 2nyg:E |
3 | 3sma:B | 268 | 252 | 0.4242 | 0.4179 | 0.4444 | 1.65e-75 | 3sma:A, 3sma:C, 3sma:D |
4 | 7q1d:D | 272 | 262 | 0.2803 | 0.2721 | 0.2824 | 1.67e-38 | 7mqk:A, 7mqk:B, 7mqk:C, 7mqk:D, 7mql:A, 7mql:B, 7mql:C, 7mql:D, 7mqm:A, 7mqm:B, 7mqm:C, 7mqm:D, 7q0q:A, 7q0q:B, 7q10:A, 7q1d:A, 7q1d:B, 7q1d:C, 7q1x:A |
5 | 5ht0:C | 261 | 266 | 0.3068 | 0.3103 | 0.3045 | 1.68e-31 | 5ht0:A, 5ht0:B, 5ht0:D, 5ht0:E, 5ht0:F, 7kes:A, 7kes:B, 6mn0:A, 6mn0:B, 6mn0:C, 6mn0:F, 6mn0:D, 6mn0:E, 6mn1:A, 6mn1:B, 6mn2:A, 6mn2:B |
6 | 6mn5:D | 260 | 239 | 0.2652 | 0.2692 | 0.2929 | 1.17e-29 | 6mn3:A, 6mn3:B, 6mn4:A, 6mn4:B, 6mn4:C, 6mn4:D, 6mn4:E, 6mn4:F, 6mn5:A, 6mn5:B, 6mn5:C, 6mn5:E, 6mn5:F |
7 | 6bc2:A | 268 | 270 | 0.2917 | 0.2873 | 0.2852 | 1.42e-29 | 6bbz:A, 6bc3:A, 6bc4:A, 6bc5:A, 6bc7:A, 6np2:A, 6np3:A, 6np4:A, 6np5:A, 6nti:A, 6ntj:A, 6o5u:A |
8 | 6mb6:A | 268 | 253 | 0.2727 | 0.2687 | 0.2846 | 1.75e-21 | 6mb4:B, 6mb5:A, 6mb6:C, 6mb7:A, 6mb9:A, 6mb9:B, 6mb9:D, 6mb9:C |
9 | 4rww:A | 113 | 35 | 0.0455 | 0.1062 | 0.3429 | 1.0 | 4rww:B, 4rww:C |
10 | 8s9x:A | 770 | 38 | 0.0492 | 0.0169 | 0.3421 | 1.2 | 8s9t:A, 8s9u:A, 8s9v:A |
11 | 5aec:A | 364 | 52 | 0.0644 | 0.0467 | 0.3269 | 3.9 | 5aec:B, 4uwm:A, 4uwm:B |
12 | 1pft:A | 50 | 23 | 0.0379 | 0.2000 | 0.4348 | 5.4 | |
13 | 6xyw:Az | 82 | 53 | 0.0682 | 0.2195 | 0.3396 | 7.0 | |
14 | 7r6r:A | 167 | 25 | 0.0417 | 0.0659 | 0.4400 | 8.3 | 7tz1:A |
15 | 4rv9:A | 419 | 53 | 0.0530 | 0.0334 | 0.2642 | 9.5 | 4rvd:A, 4rvf:A, 4rvg:A, 4rvh:A |
16 | 8ul7:A | 363 | 51 | 0.0568 | 0.0413 | 0.2941 | 9.6 | 8ule:A, 8um0:A |