MNASTITLHVPQRSKIAGRMDFFQMVSGALLILFLWAHMMLVSSVILSPSLMNGIAWFFEATYMAQIGGPAVFVLMVVHF
ILAARKMPFKQDEWKTFRVHACMLHHKDTTMWVVQVISAIFILVLGAVHMFVVLTDLPITAAKSAARLQSGWLYLYLVLL
PLAELHVGVGFYRIGVKYGFVGRNKRKWFQKTENLMMIGFITIGLLTLVRFM
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xmj:C | 212 | 212 | 1.0000 | 1.0000 | 1.0000 | 4.78e-156 | 5xmj:G, 5xmj:K, 5xmj:O |
2 | 2bs2:F | 254 | 215 | 0.3443 | 0.2874 | 0.3395 | 2.42e-31 | 2bs2:C, 2bs3:F, 2bs3:C, 2bs4:F, 2bs4:C, 1e7p:C, 1e7p:F, 1e7p:I, 1e7p:L, 1qlb:C, 1qlb:F |
3 | 7s5f:B | 309 | 36 | 0.0708 | 0.0485 | 0.4167 | 0.72 | 7s5f:A, 7s5f:C, 7s5f:D |
4 | 1v1a:A | 301 | 21 | 0.0613 | 0.0432 | 0.6190 | 2.8 | 1v1a:B, 1v1b:A, 1v1b:D, 1v1b:B, 1v1b:C |
5 | 5v3u:A | 131 | 65 | 0.0896 | 0.1450 | 0.2923 | 3.7 | 5v3t:A, 5v3t:B, 5v3u:B, 5v3v:A, 5v3v:B |
6 | 4uur:A | 124 | 27 | 0.0566 | 0.0968 | 0.4444 | 4.5 | 4uur:B |
7 | 6znq:B | 711 | 55 | 0.0613 | 0.0183 | 0.2364 | 7.8 | 6znp:B |
8 | 6znp:A | 748 | 55 | 0.0613 | 0.0174 | 0.2364 | 7.8 | 6znq:A |