BioLiP

>protein
MMLIDCPNCGPRNENEFKYGGEAHVAYPADPHALSDKQWSRYLFYRQNKKGIFAERWVHAAGCRKWFNALRDTVTYEFKA
IYPAGAPRPEI

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2gag:D	91	91	1.0000	1.0000	1.0000	1.01e-66	2gah:D
2	3ad7:D	91	91	0.8462	0.8462	0.8462	1.19e-57	3ad8:D, 3ad9:D, 3ada:D, 1vrq:D, 1x31:D
3	7w2i:A	183	54	0.1538	0.0765	0.2593	0.42	7w2i:B, 7w2i:C, 7w2i:D
4	5t0h:V	480	51	0.1758	0.0333	0.3137	1.1	6epe:S, 6epf:S, 5vft:V
5	4kns:A	285	62	0.1758	0.0561	0.2581	1.1	4kns:B, 4kns:C, 4kns:D, 4kns:E, 4kns:F, 4knt:A, 4knt:B, 4knt:C, 4knu:A, 4knu:B, 4knu:C, 4knu:D, 4knu:E, 4knu:F
6	7r07:F	600	63	0.1758	0.0267	0.2540	1.1	7r06:A, 7r06:F, 7r06:B, 7r06:E, 7r06:C, 7r06:D, 7r07:A, 7r07:B, 7r07:C, 7r07:D, 7r07:E
7	7rhq:A	974	40	0.1429	0.0133	0.3250	2.0	7rhr:A
8	5t16:A	276	35	0.1648	0.0543	0.4286	2.3	2lbs:B, 2lup:B, 4oog:C, 5t16:B, 5t16:I, 5t16:J, 1t4l:B
9	1a82:A	224	55	0.1978	0.0804	0.3273	2.8	1bs1:A, 1dad:A, 1dae:A, 1daf:A, 1dag:A, 1dah:A, 1dai:A, 1dak:A, 1dam:A
10	1bw9:A	350	24	0.0989	0.0257	0.3750	5.0	1bw9:B, 1bxg:A, 1bxg:B, 1c1d:A, 1c1d:B, 1c1x:A, 1c1x:B
11	3sbx:A	177	35	0.1099	0.0565	0.2857	5.5	3sbx:B, 3sbx:C, 3sbx:D, 3sbx:E, 3sbx:F, 3sbx:G, 3sbx:H
12	2ynm:D	488	54	0.1319	0.0246	0.2222	8.6

[Back]