BioLiP

>protein
MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPEGNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRG
QAAGTCEIYWANWGYNRIRLESADEKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVK
YVSGQQTNGGTKQG

The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7uo3:A	174	174	1.0000	1.0000	1.0000	9.95e-131	7uma:A, 7uo8:A
2	6bwi:A	816	53	0.0920	0.0196	0.3019	2.2	6bwi:D, 6bwi:B, 6bwi:C
3	6rrn:A	989	76	0.1207	0.0212	0.2763	2.9
4	9b8w:A	993	53	0.0920	0.0161	0.3019	3.5	9b8w:B, 9b8w:C, 9b8w:D, 9b8x:A, 9b8y:A, 9b8y:B, 9b8y:C, 9b8y:D, 9b8z:A, 9b90:A, 9b90:B, 9b90:C, 9b90:D, 9b91:A, 9b92:A, 9b92:B, 9b92:C, 9b92:D, 9b94:A, 9b94:B, 9b94:C, 9b94:D, 6bqr:A, 6bqr:C, 6bqr:B, 6bqr:D
5	5wp6:A	977	53	0.0920	0.0164	0.3019	3.6	6bqv:A, 6bqv:C, 6bqv:B, 6bqv:D, 5wp6:B, 5wp6:C, 5wp6:D
6	3cf4:A	766	93	0.1379	0.0313	0.2581	4.0
7	2iwa:A	254	34	0.0575	0.0394	0.2941	4.7	2faw:A, 2faw:B
8	6y2n:A	306	40	0.0862	0.0490	0.3750	6.4
9	6fzw:D	180	26	0.0575	0.0556	0.3846	6.8
10	9en2:A	241	26	0.0575	0.0415	0.3846	7.1	6fzv:D
11	6jni:A	145	39	0.0747	0.0897	0.3333	9.1	6jgw:B, 6jgw:A, 6jgx:A, 6jgx:B, 6jni:B, 6jni:H, 6jni:C, 6jni:D, 6jni:E, 6jni:F, 6jni:G, 6jyw:A, 6jyw:B

[Back]