MLVVEVANGRSLVWGAEAVQALRERLGVGGRTVGALPRGPRQNSRLGLPLLLMPEEARLLAEIGAVTLVSAPRPDSRHHS
LALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASPRSALLVQLATARPRPVKARPLDWRV
QSKDWPHAGRPAHELRYSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFAAHYIAQCWAPEDTIPLQDLVAAGRLGTSV
RKTLLLCSPQPDGKVVYTSLQWAS
The query sequence (length=264) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hmy:B | 264 | 264 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8hmz:B, 8iss:C |
2 | 7uxa:A | 230 | 264 | 0.8371 | 0.9609 | 0.8371 | 1.40e-148 | |
3 | 7zrz:AP1 | 184 | 111 | 0.4167 | 0.5978 | 0.9910 | 9.16e-80 | |
4 | 7zrz:AP1 | 184 | 74 | 0.2803 | 0.4022 | 1.0000 | 3.79e-42 | |
5 | 2gjw:A | 308 | 76 | 0.1061 | 0.0909 | 0.3684 | 4.31e-05 | 2gjw:B, 2gjw:C, 2gjw:D |
6 | 8hmy:A | 314 | 86 | 0.0909 | 0.0764 | 0.2791 | 0.25 | 8hmz:A |
7 | 2dcm:A | 662 | 75 | 0.0758 | 0.0302 | 0.2667 | 0.84 | 2eep:A, 2z3z:A |
8 | 7zrz:BP4 | 104 | 85 | 0.0795 | 0.2019 | 0.2471 | 1.1 | |
9 | 8iss:B | 223 | 86 | 0.0871 | 0.1031 | 0.2674 | 1.4 | 7uxa:C |
10 | 4r2b:A | 395 | 92 | 0.0985 | 0.0658 | 0.2826 | 3.0 | 4r2b:B |
11 | 1e93:A | 476 | 84 | 0.0871 | 0.0483 | 0.2738 | 4.0 | 2cag:A, 2cah:A, 1h6n:A, 1h7k:A, 3hb6:A, 1m85:A, 1mqf:A, 1nm0:A |
12 | 7vud:A | 535 | 40 | 0.0530 | 0.0262 | 0.3500 | 7.5 | |
13 | 7ypw:A | 388 | 61 | 0.0720 | 0.0490 | 0.3115 | 7.9 | 7yr8:A |