MLPSYDFFIHPMNLVELKKDIWSDSPVPAKLTYGKKKYDIDIVYRGAHIREFEKKSYHVMFYKPKKFQGAKEFHLNSEFM
DPSLIRNKLSLDFFHDIGVLSPKSQHVFIKINGQIQGVYLQLESVDENFLKNRGLPSGSIYYAIDDDANFSLMSERDKDV
KTELFAGYEFKYSNENSEEQLSEFVFQANALSREAYEKEIGKFLHVDKYLRWLAGVIFTQNFDGFVHNYALYHNDETNLF
EVIPWDYDATWGRDVQGRPLNHEYIRIQGYNTLSARLLDIPIFRKQYRSILEEILAEQFTVSFMMPKVESLCESIRPYLL
QDPYMKEKLETFDQEADMIEEYINKRRKYIQDHLHELD
The query sequence (length=358) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jda:A | 359 | 358 | 1.0000 | 0.9972 | 1.0000 | 0.0 | 5jd9:A |
2 | 7qep:N2 | 93 | 69 | 0.0503 | 0.1935 | 0.2609 | 0.24 | |
3 | 1fsg:A | 233 | 67 | 0.0559 | 0.0858 | 0.2985 | 6.1 | 1dbr:A, 1dbr:B, 1dbr:D, 1fsg:C, 1qk3:A, 1qk3:B, 1qk3:C, 1qk3:D, 1qk4:A, 1qk4:B, 1qk4:C, 1qk4:D, 1qk5:A, 1qk5:B |
4 | 6zj9:A | 220 | 95 | 0.0698 | 0.1136 | 0.2632 | 9.8 | 6zjc:B, 6zjc:A, 6zjc:D, 6zjc:C |