BioLiP

>protein
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNEADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQ
EGRRVFVTEVVCDSVQFLE

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8gw5:A	99	99	0.9798	0.9798	0.9798	2.19e-65	7ym1:A
2	6bhx:C	102	99	0.8081	0.7843	0.8081	1.70e-53	6bhx:A, 6bhx:B
3	7dep:B	102	104	0.8384	0.8137	0.7981	2.29e-52
4	3vdy:A	101	104	0.5455	0.5347	0.5192	1.91e-32	3vdy:B
5	2vw9:A	108	106	0.4040	0.3704	0.3774	1.25e-19	2vw9:B
6	1eqq:B	120	100	0.3535	0.2917	0.3500	1.52e-16	1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D
7	5odn:D	106	97	0.3636	0.3396	0.3711	1.56e-16	5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H
8	3a5u:A	118	100	0.4141	0.3475	0.4100	9.62e-16	3a5u:B
9	6irq:C	104	95	0.3434	0.3269	0.3579	3.15e-14	6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D
10	5odp:G	100	80	0.2828	0.2800	0.3500	4.60e-11	5odp:A
11	3ulp:C	116	99	0.3131	0.2672	0.3131	1.84e-09	3ulp:A, 3ulp:B, 3ulp:D
12	3udg:C	214	76	0.2525	0.1168	0.3289	2.60e-08	3udg:B, 3udg:A
13	3udg:C	214	85	0.2525	0.1168	0.2941	0.001	3udg:B, 3udg:A
14	6rup:A	111	105	0.3030	0.2703	0.2857	1.24e-06	6rup:B, 8uzt:A, 8uzt:C, 8uzt:D
15	8uzt:B	100	101	0.3030	0.3000	0.2970	4.10e-06
16	2ccz:A	121	107	0.2828	0.2314	0.2617	0.002	2ccz:B, 1v1q:A, 1v1q:B
17	2ex8:A	456	42	0.1616	0.0351	0.3810	0.84	2ex6:A, 2ex9:A, 2exa:A, 2exb:A
18	1odh:A	157	46	0.1414	0.0892	0.3043	0.86
19	4hyj:A	236	35	0.1313	0.0551	0.3714	1.00	4hyj:B
20	5l3w:A	297	32	0.1414	0.0471	0.4375	8.6	5l3s:B, 5l3s:D, 5l3s:F, 5l3s:H

[Back]