BioLiP

>protein
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIPVSYLYTPEDDLAQIILTWNE
LNEQERKRINFYIRK

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4jqd:E	97	95	1.0000	0.9794	1.0000	7.77e-67	4jcx:A, 4jcx:B, 4jcy:A, 4jcy:B, 4jqd:F, 4jqd:A, 4jqd:B
2	4utu:A	229	65	0.2421	0.1004	0.3538	0.019	4utu:B, 4utw:A, 4utw:B, 4utw:C, 4utw:D
3	5ghg:B	433	54	0.1789	0.0393	0.3148	0.74	5ghf:A
4	6knb:B	1120	41	0.1684	0.0143	0.3902	1.2	6knc:B
5	5f55:A	705	85	0.2316	0.0312	0.2588	2.2	5f54:A, 5f56:A, 6lrd:A
6	8ur2:B	99	42	0.1684	0.1616	0.3810	2.4
7	2bvf:A	453	68	0.2211	0.0464	0.3088	4.2	2bvf:B, 2bvg:A, 2bvg:B, 2bvg:C, 2bvg:D, 2bvh:A, 2bvh:B, 2bvh:C, 2bvh:D
8	4ryk:A	295	72	0.1895	0.0610	0.2500	5.4
9	6uzi:C	470	29	0.1263	0.0255	0.4138	5.4	6uzi:A, 6uzi:B, 6uzi:D
10	7bxq:A	399	26	0.1158	0.0276	0.4231	6.1	7bxq:B, 7bxr:A, 7bxr:B, 7bxs:A, 7bxs:B
11	7mq8:LU	445	53	0.1789	0.0382	0.3208	6.5	7mq9:LU, 7mqa:LU
12	3geh:A	442	58	0.2105	0.0452	0.3448	7.0
13	1y07:C	124	71	0.2000	0.1532	0.2676	7.1	1y07:A, 1y07:B, 1y07:D
14	8w7g:A	390	45	0.1474	0.0359	0.3111	7.8
15	7qoo:N	320	40	0.1368	0.0406	0.3250	8.1	6c0w:K, 6muo:M, 6mup:M, 6mup:N, 7r5s:N, 7u46:K, 7u47:K, 7u47:V, 7u4d:K, 7u4d:V, 7xhn:N, 7xho:N, 7ywx:N
16	3zyy:X	628	56	0.1789	0.0271	0.3036	8.4	4c1n:J, 4c1n:I, 4c1n:K, 4c1n:X, 3zyy:Y
17	7r5v:N	297	40	0.1368	0.0438	0.3250	9.2	7yyh:N
18	7xc4:A	127	21	0.1053	0.0787	0.4762	9.5	7xc4:B

[Back]