MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIPVSYLYTPEDDLAQIILTWNE
LNEQERKRINFYI
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jqd:E | 97 | 93 | 1.0000 | 0.9588 | 1.0000 | 1.75e-65 | 4jcx:A, 4jcx:B, 4jcy:A, 4jcy:B, 4jqd:F, 4jqd:A, 4jqd:B |
2 | 4utu:A | 229 | 65 | 0.2473 | 0.1004 | 0.3538 | 0.019 | 4utu:B, 4utw:A, 4utw:B, 4utw:C, 4utw:D |
3 | 5ghg:B | 433 | 54 | 0.1828 | 0.0393 | 0.3148 | 0.69 | 5ghf:A |
4 | 6knb:B | 1120 | 41 | 0.1720 | 0.0143 | 0.3902 | 1.4 | 6knc:B |
5 | 5f55:A | 705 | 85 | 0.2366 | 0.0312 | 0.2588 | 2.1 | 5f54:A, 5f56:A, 6lrd:A |
6 | 8ur2:B | 99 | 42 | 0.1720 | 0.1616 | 0.3810 | 2.4 | |
7 | 2bvf:A | 453 | 68 | 0.2258 | 0.0464 | 0.3088 | 4.4 | 2bvf:B, 2bvg:A, 2bvg:B, 2bvg:C, 2bvg:D, 2bvh:A, 2bvh:B, 2bvh:C, 2bvh:D |
8 | 4ryk:A | 295 | 67 | 0.1720 | 0.0542 | 0.2388 | 4.9 | |
9 | 7mq8:LU | 445 | 53 | 0.1828 | 0.0382 | 0.3208 | 5.3 | 7mq9:LU, 7mqa:LU |
10 | 7bxq:A | 399 | 26 | 0.1183 | 0.0276 | 0.4231 | 5.7 | 7bxq:B, 7bxr:A, 7bxr:B, 7bxs:A, 7bxs:B |
11 | 1y07:C | 124 | 71 | 0.2043 | 0.1532 | 0.2676 | 6.4 | 1y07:A, 1y07:B, 1y07:D |
12 | 8w7g:A | 390 | 45 | 0.1505 | 0.0359 | 0.3111 | 6.9 | |
13 | 3geh:A | 442 | 58 | 0.2151 | 0.0452 | 0.3448 | 7.1 | |
14 | 3zyy:X | 628 | 56 | 0.1828 | 0.0271 | 0.3036 | 8.0 | 4c1n:J, 4c1n:I, 4c1n:K, 4c1n:X, 3zyy:Y |
15 | 7xc4:A | 127 | 21 | 0.1075 | 0.0787 | 0.4762 | 9.4 | 7xc4:B |