MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRLKAH
PEQGGAALE
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5jdx:A | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 2.21e-61 | 7thn:E |
| 2 | 2n5h:A | 90 | 64 | 0.2584 | 0.2556 | 0.3594 | 3.67e-06 | 2n5i:A, 6o6e:E |
| 3 | 5nyw:J | 235 | 50 | 0.1910 | 0.0723 | 0.3400 | 0.24 | |
| 4 | 6uo8:A | 689 | 47 | 0.1573 | 0.0203 | 0.2979 | 0.58 | 7c7q:A, 7c7s:A, 7ca3:A, 7cum:A, 7eb2:C, 4mqf:A, 4mr7:A, 4mr8:A, 4mr9:A, 4mrm:A, 4ms1:A, 4ms3:A, 4ms4:A, 6uo9:A, 6w2x:A, 6w2y:A, 6w2y:B, 6wiv:A |
| 5 | 3nzp:B | 591 | 65 | 0.2360 | 0.0355 | 0.3231 | 0.70 | 3nzp:A |
| 6 | 6tc9:A | 259 | 58 | 0.1685 | 0.0579 | 0.2586 | 6.9 | 6tc6:A, 6tc6:C, 6tc9:C |
| 7 | 7d58:E | 210 | 59 | 0.2022 | 0.0857 | 0.3051 | 8.4 | 8a3y:E, 8a40:E, 7ae1:E, 7ae3:E, 7aea:E, 7b0y:E, 8b3d:E, 8b3f:E, 7dn3:E, 6exv:E, 7fji:E, 7fjj:E, 6gmh:E, 6gml:E, 8gxq:PE, 8iue:E, 8iuh:E, 5iy7:E, 5iy8:E, 5iy9:E, 5iyc:E, 5iyd:E, 8oeu:E, 8oev:E, 8oew:E, 8of0:E, 5oik:E, 7okx:E, 7oky:E, 7ol0:E, 7oo3:E, 7oob:E, 7oop:E, 7opc:E, 7opd:E, 8p4a:E, 8p4b:E, 8p4f:E, 7pks:E, 8rbx:E, 8s51:E, 8s52:E, 8s54:E, 8s5n:E, 6ted:E, 8uhd:E, 7und:E, 8w8e:E, 8w8f:E, 8wak:s, 8wal:s, 8wan:s, 8wao:s, 8wap:s, 8waq:s, 8war:s, 8was:s, 8wat:s, 8wau:s, 8wav:s, 8waw:s, 8wax:s, 8way:s, 8waz:s, 8wb0:s |
| 8 | 7cyx:A | 363 | 33 | 0.1798 | 0.0441 | 0.4848 | 8.8 | 7cyx:B |
umich.edu