MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTP
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c9l:Y | 63 | 62 | 0.9839 | 0.9683 | 0.9839 | 6.04e-40 | 2c9l:Z, 2c9n:Y, 2c9n:Z, 7nx5:A, 7nx5:B, 7nx5:E, 7nx5:F, 5szx:A, 5szx:B |
2 | 8k8c:A | 60 | 51 | 0.3065 | 0.3167 | 0.3725 | 0.001 | 8k8c:B, 1nwq:A, 1nwq:C |
3 | 3en9:A | 519 | 24 | 0.1774 | 0.0212 | 0.4583 | 0.37 | 3en9:B, 3enh:A, 3enh:B, 5jmv:A, 5jmv:B, 5jmv:C, 2vwb:A, 2vwb:B |
4 | 1aot:F | 106 | 24 | 0.2097 | 0.1226 | 0.5417 | 2.9 | 1aou:F, 2mrk:A, 4u1p:A |
5 | 8k1l:A | 979 | 23 | 0.1290 | 0.0082 | 0.3478 | 5.3 | |
6 | 1h88:B | 71 | 51 | 0.2742 | 0.2394 | 0.3333 | 5.4 | 2e42:A, 2e42:B, 2e43:A, 2e43:B, 1gtw:A, 1gtw:B, 1gu4:A, 1gu4:B, 1gu5:A, 1gu5:B, 1h88:A, 1h89:A, 1h89:B, 1h8a:A, 1h8a:B, 1hjb:A, 1hjb:B, 1hjb:D, 1hjb:E, 1io4:A, 1io4:B, 8k8d:A, 8k8d:B, 7l4v:A, 7l4v:B, 6mg1:A, 6mg1:B, 6mg2:A, 6mg2:B, 6mg3:A, 6mg3:B, 7upz:A, 7upz:B |
7 | 2aqc:A | 63 | 18 | 0.1129 | 0.1111 | 0.3889 | 6.6 | 2apo:B |
8 | 8tj5:P | 1641 | 35 | 0.1613 | 0.0061 | 0.2857 | 8.3 | 8tj5:N |