MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2es2:A | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 3.73e-43 | 3pf4:B, 3pf5:B, 3pf5:A |
2 | 1c9o:A | 66 | 65 | 0.8209 | 0.8333 | 0.8462 | 6.56e-35 | 1c9o:B, 2hax:A, 2hax:B |
3 | 7ot5:B | 66 | 64 | 0.5672 | 0.5758 | 0.5938 | 2.48e-21 | |
4 | 6a6j:A | 90 | 66 | 0.4328 | 0.3222 | 0.4394 | 2.12e-12 | 6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A |
5 | 7f3i:A | 93 | 66 | 0.4179 | 0.3011 | 0.4242 | 1.15e-11 | 7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A |
6 | 4a75:A | 89 | 69 | 0.4030 | 0.3034 | 0.3913 | 2.24e-10 | 4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D |
7 | 5udz:A | 139 | 69 | 0.4030 | 0.1942 | 0.3913 | 3.90e-10 | 8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B |
8 | 7oii:B | 39 | 37 | 0.3433 | 0.5897 | 0.6216 | 1.78e-09 | |
9 | 2ix1:A | 643 | 26 | 0.2090 | 0.0218 | 0.5385 | 0.12 | 2id0:A, 2id0:B, 2id0:C, 2id0:D, 2ix0:A |
10 | 7zhh:A | 219 | 61 | 0.3582 | 0.1096 | 0.3934 | 0.12 | |
11 | 2uvp:C | 186 | 32 | 0.1791 | 0.0645 | 0.3750 | 1.8 | 2uvp:B |
12 | 1z7m:B | 318 | 22 | 0.1940 | 0.0409 | 0.5909 | 2.3 | 1z7m:D |
13 | 4v6w:CB | 414 | 40 | 0.2239 | 0.0362 | 0.3750 | 3.6 | 6xu6:CB, 6xu7:CB, 6xu8:CB |
14 | 2ia4:B | 278 | 16 | 0.1343 | 0.0324 | 0.5625 | 3.8 | 2ia4:A |
15 | 8ovo:A | 503 | 16 | 0.1343 | 0.0179 | 0.5625 | 4.2 | 8ovo:B, 8ovp:A, 8ovp:B, 2vha:A, 2vha:B |
16 | 2ohf:A | 327 | 32 | 0.1791 | 0.0367 | 0.3750 | 4.9 | |
17 | 1xzq:A | 449 | 22 | 0.1642 | 0.0245 | 0.5000 | 5.8 | 1xzq:B |
18 | 2cb1:A | 404 | 14 | 0.1493 | 0.0248 | 0.7143 | 5.9 | |
19 | 3vyl:A | 297 | 20 | 0.1194 | 0.0269 | 0.4000 | 9.5 | 3vyl:B, 3vyl:C, 3vyl:D, 3vyl:E, 3vyl:F, 3vyl:G, 3vyl:H |