MKTTISVIKADIGSLAGHHIVHPDTMAAANKVLASAKEQGIILDYYITHVGDDLQLIMTHTRGELDTKVHETAWNAFKEA
AKVAKDLGLYAAGQDLLSDSFSGNVRGLGPGVAEMEIEERASEPIAIFMADKTEPGAYNLPLYKMFADPFNTPGLVIDPT
MHGGFKFEVLDVYQGEAVMLSAPQEIYDLLALIGTPARYVIRRVYRNEDNLLAAVVSIERLNLIAGKYVGKDDPVMIVRL
QHGLPALGEALEAFAFPHLVPGWMRGSHYGPLMPVSQRDAKATRFDGPPRLLGLGFNVKNGRLVGPTDLFDDPAFDETRR
LANIVADYMRRHGPFMPHRLEPTEMEYTTLPLRFKK
The query sequence (length=356) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1umg:A | 359 | 362 | 0.9888 | 0.9805 | 0.9724 | 0.0 | 3r1m:A |
2 | 3t2d:A | 390 | 362 | 0.6096 | 0.5564 | 0.5994 | 4.92e-155 | 3t2b:A, 3t2c:A, 3t2e:A, 3t2f:A, 3t2g:A |
3 | 8ity:3 | 374 | 117 | 0.0871 | 0.0829 | 0.2650 | 1.5 | 8iue:3, 8iuh:3, 7xur:B, 7zwc:b, 7zwd:b, 7zx7:b, 7zx8:b, 7zxe:b |
4 | 1z2m:A | 152 | 76 | 0.0534 | 0.1250 | 0.2500 | 2.8 | 3phx:B |
5 | 1lpc:A | 254 | 43 | 0.0393 | 0.0551 | 0.3256 | 9.7 | 1lpd:A |