BioLiP

>protein
MKTIFTKKQTEELLNDISIEKQKELFNSMHDFRSQHAKEARIPGWSDKYNKLEKKMLSDFEEVTGIKYDTLESELIWDNL
SNKFLY

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8wrx:A	86	86	1.0000	1.0000	1.0000	2.55e-59
2	4ine:A	431	59	0.2209	0.0441	0.3220	1.7	4ine:B
3	8cf5:Aa	842	20	0.0930	0.0095	0.4000	1.8	8cdr:Aa, 8ceh:Aa, 8cg8:Aa, 8civ:Aa, 8cku:Aa, 8cmj:Aa, 2e1r:A, 8eub:DC, 8evq:DC, 8evr:DC, 8evs:DC, 8ewb:DC, 6gq1:AZ, 6gqb:AZ, 6gqv:AX, 5it7:1, 5juo:DC, 5jup:DC, 5jus:DC, 5jut:DC, 5juu:DC, 8k2d:CD, 1n0u:A, 2npf:A, 2npf:B, 7osa:eEF2, 7osm:eEF2, 2p8w:T, 2p8x:T, 2p8y:T, 2p8z:T, 1u2r:A, 4v4b:AT, 1zm2:E
4	7y6c:D	71	61	0.1977	0.2394	0.2787	2.6	7y6c:A
5	4rru:A	189	26	0.1279	0.0582	0.4231	2.7	7fdm:A, 7fdm:B, 4rqw:A, 4rs9:A, 5t0q:A, 4ywc:A, 4ywc:B, 4yz6:A
6	3q85:B	151	42	0.1860	0.1060	0.3810	4.8	4aii:A, 4aii:B, 3q85:A
7	6n1x:A	377	30	0.1744	0.0398	0.5000	5.0	6d9t:A
8	1ea0:A	1452	65	0.2209	0.0131	0.2923	7.8	1ea0:B
9	6s6t:A	1472	65	0.2209	0.0129	0.2923	7.8	6s6s:A, 6s6s:B, 6s6s:C, 6s6s:D, 6s6t:B, 6s6t:C, 6s6t:D, 6s6u:A, 6s6u:B, 6s6u:C, 6s6u:D, 6s6u:E, 6s6u:F, 6s6x:A, 6s6x:B, 6s6x:C, 6s6x:D, 6s6x:E, 6s6x:F, 2vdc:A, 2vdc:B, 2vdc:C, 2vdc:D, 2vdc:E, 2vdc:F

[Back]