BioLiP

>protein
MKRTELDMYDDIFAVLERFPNVHNPHRVRIRRVGTKYFIEMDIEVDGKMSVKDAHELTVKIRKEMLKRRDDIEDVTIHVE
PLGNVE

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6vda:A	86	86	1.0000	1.0000	1.0000	3.51e-58
2	2qfi:A	286	71	0.2326	0.0699	0.2817	2.09e-05	3h90:A, 3h90:B, 3h90:C, 3h90:D, 2qfi:B
3	3byr:A	89	59	0.2209	0.2135	0.3220	6.59e-05
4	6h5k:A	91	69	0.2442	0.2308	0.3043	6.12e-04	6g55:A, 6h5m:A, 6h5u:B, 6h5u:A, 6h5u:C, 6h87:A, 5hsp:A
5	8f6k:B	287	63	0.2326	0.0697	0.3175	0.001	8f6e:A, 8f6e:B, 8f6f:A, 8f6f:B, 8f6h:A, 8f6h:B, 8f6i:B, 8f6i:A, 8f6j:B, 8f6j:A, 8f6k:A, 8f6k:C, 8f6k:D, 7kzz:B, 7kzz:A, 5vrf:B, 5vrf:A
6	7wtt:K	1022	50	0.1628	0.0137	0.2800	1.0	7wtu:K, 7wtv:K, 7wtw:K, 7wtx:K, 7wtz:K, 7wu0:K
7	5ce3:B	598	44	0.1628	0.0234	0.3182	1.3	5ce3:D
8	5aa5:G	561	68	0.1977	0.0303	0.2500	2.4	5aa5:C, 5aa5:E, 5aa5:K, 5aa5:I, 5aa5:L
9	6yet:A	104	42	0.1744	0.1442	0.3571	2.7
10	2ynm:C	417	41	0.1744	0.0360	0.3659	3.9
11	7adr:E	466	71	0.2093	0.0386	0.2535	5.2	7adr:B, 7ady:B, 7ady:E, 7aiz:B, 7aiz:E, 6fea:B, 6fea:E, 5n6y:B, 5n6y:E
12	6rxt:UA	839	76	0.2326	0.0238	0.2632	7.1	5oql:A, 6rxu:UA, 6rxv:UA, 6rxx:UA, 6rxy:UA, 6rxz:UA

[Back]