BioLiP

>protein
MKQFEIVIEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKLAQIGDEINEKWPGTITSIVH
RIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVPIWKKEIKWQGH

The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2qie:A	136	136	1.0000	0.9632	0.9632	1.58e-90	2qie:E, 2qie:H, 2qie:K
2	2wp4:B	132	119	0.3435	0.3409	0.3782	1.29e-22
3	6nbe:N	186	42	0.1221	0.0860	0.3810	0.15	6nas:N, 6nbw:N
4	2d7d:A	621	58	0.1145	0.0242	0.2586	1.2	2nmv:A, 3v4r:B, 3v4r:A
5	1zun:B	394	48	0.1298	0.0431	0.3542	1.5
6	2fdc:A	505	58	0.1069	0.0277	0.2414	2.0
7	5hrf:A	178	45	0.0916	0.0674	0.2667	3.3	7cpw:A, 7cpw:B, 8e9a:A, 8e9a:B, 5hr9:A, 5hr9:B, 5hrb:A, 5hrd:A, 5hrd:B, 5hrd:C, 5hrd:D, 5hre:A, 5hrf:B, 5hrg:A, 5hrg:B, 5hrh:A, 5hrh:B, 5hri:A, 5hri:B, 5hrk:A, 5hrk:B, 5hrl:A, 5hrl:B, 8ild:A, 8ild:B, 8ile:B, 8ile:A, 8ilf:B, 8ilf:A, 8ilg:A, 8ilg:B, 8ilh:B, 8ilh:A, 8ilh:C, 8ilh:D, 8ili:A, 8ili:B, 8ili:C, 8ili:D, 2m2u:A, 2m2w:A, 5xm8:A, 5xm8:B, 5xm8:C, 5xm8:D, 5xm9:A, 5xm9:B, 5xm9:C, 5xm9:D, 5xma:A, 5xma:B
8	2gbx:D	170	40	0.1069	0.0824	0.3500	4.1
9	4xup:A	330	115	0.2366	0.0939	0.2696	5.3	4xun:A, 4xun:B, 4xun:C, 4xuo:A, 4xuo:B, 4xup:B, 4xup:C, 4xup:D, 4xup:E, 4xup:F, 4xuq:A, 4xuq:B, 4xuq:C, 4xur:A, 4xur:B, 4xur:C, 4xut:A, 4xut:B, 4xut:C
10	3ayx:A	595	42	0.1069	0.0235	0.3333	7.2	3ayx:C, 3ayz:A, 3ayz:C, 5y34:A, 5y34:C
11	3o5b:A	479	39	0.0840	0.0230	0.2821	9.3	3o5b:B, 3o80:A, 3o8m:A
12	5thm:A	520	34	0.0840	0.0212	0.3235	9.7

[Back]