MKPVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGKQSL
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1lbg:A | 357 | 62 | 0.9516 | 0.1653 | 0.9516 | 1.22e-34 | 2bjc:A, 2bjc:B, 1cjg:A, 1cjg:B, 1efa:A, 1efa:B, 1efa:C, 1jwl:B, 1jwl:A, 1jwl:C, 2kei:A, 2kei:B, 2kej:A, 2kej:B, 2kek:A, 2kek:B, 1l1m:A, 1l1m:B, 1lbg:D, 1lbh:A, 1lbh:B, 1lbh:C, 1lbh:D, 1lcc:A, 1lcd:A, 1osl:A, 1osl:B, 2p9h:A, 2p9h:B, 2paf:A, 2paf:B, 2pe5:A, 2pe5:B, 2pe5:C, 4rzt:A, 4rzt:B, 4rzt:C, 4rzt:D, 1tlf:A, 1tlf:B, 1tlf:C, 1tlf:D |
2 | 3oqo:A | 333 | 58 | 0.4839 | 0.0901 | 0.5172 | 3.14e-11 | 3oqm:A, 3oqm:C, 3oqn:A, 3oqn:C, 3oqo:C |
3 | 1rzr:G | 332 | 58 | 0.4839 | 0.0904 | 0.5172 | 8.57e-11 | 2jcg:A, 2nzu:G, 2nzv:G, 1rzr:C, 1rzr:A, 1rzr:D, 1sxg:B, 1zvv:A, 1zvv:B, 1zvv:G |
4 | 5ysz:A | 327 | 53 | 0.4355 | 0.0826 | 0.5094 | 1.65e-09 | |
5 | 1jft:A | 340 | 52 | 0.3871 | 0.0706 | 0.4615 | 3.34e-07 | 1bdh:A, 1bdi:A, 1jfs:A, 1jh9:A, 1pnr:A, 2pua:A, 2pub:A, 2puc:A, 2pud:A, 2pue:A, 2puf:A, 2pug:A, 1qp0:A, 1qp4:A, 1qp7:A, 1qpz:A, 1qqa:A, 1qqb:A, 1vpw:A, 1wet:A, 1zay:A |
6 | 7ce1:T | 292 | 52 | 0.2903 | 0.0616 | 0.3462 | 3.88e-05 | |
7 | 7ce1:S | 259 | 52 | 0.2903 | 0.0695 | 0.3462 | 4.35e-05 | |
8 | 7ce1:K | 333 | 52 | 0.2903 | 0.0541 | 0.3462 | 4.58e-05 | 7cdx:A, 7cdx:B, 7ce1:A, 7ce1:B, 7ce1:C, 7ce1:D, 7ce1:G, 7ce1:H, 7ce1:L, 7ce1:O, 7ce1:P |
9 | 5ui5:V | 323 | 25 | 0.1774 | 0.0341 | 0.4400 | 0.45 | 2o8k:A, 2o9l:A, 5ui5:I |
10 | 7qv9:M | 417 | 26 | 0.1774 | 0.0264 | 0.4231 | 1.1 | 8f1i:M, 8f1j:M, 8f1k:M, 7qwp:M, 7qxi:M, 8re4:M, 8rea:M |
11 | 5nss:M | 388 | 26 | 0.1774 | 0.0284 | 0.4231 | 1.1 | 6gfw:M, 6gh5:M, 5nsr:M |
12 | 8reb:M | 350 | 26 | 0.1774 | 0.0314 | 0.4231 | 1.7 | 8rec:M, 8red:M, 8ree:M |
13 | 6gh6:M | 315 | 26 | 0.1774 | 0.0349 | 0.4231 | 2.6 | |
14 | 4axs:A | 291 | 39 | 0.2097 | 0.0447 | 0.3333 | 2.6 | |
15 | 4i2o:A | 198 | 24 | 0.1452 | 0.0455 | 0.3750 | 3.1 | 4i2o:B |
16 | 2w57:A | 131 | 36 | 0.2258 | 0.1069 | 0.3889 | 4.0 | 2w57:B |
17 | 1svu:A | 307 | 31 | 0.2097 | 0.0423 | 0.4194 | 6.2 | |
18 | 10mh:A | 327 | 31 | 0.2097 | 0.0398 | 0.4194 | 6.2 | 2c7o:A, 2c7p:A, 2c7q:A, 2c7r:A, 5ciy:A, 3eeo:A, 1fjx:A, 1hmy:A, 2hmy:B, 2hr1:A, 2i9k:A, 1m0e:A, 1mht:A, 3mht:A, 4mht:A, 5mht:A, 6mht:A, 7mht:A, 8mht:A, 9mht:A, 1skm:A, 1svu:B, 2uyc:A, 2uyh:A, 2uz4:A, 2z6a:A, 2z6q:A, 2z6u:A, 2zcj:A |
19 | 8j6w:A | 145 | 36 | 0.2258 | 0.0966 | 0.3889 | 6.3 | |
20 | 6sga:Fd | 96 | 28 | 0.1613 | 0.1042 | 0.3571 | 6.5 | 7pua:Fd, 6sgb:Fd |
21 | 4im7:A | 483 | 40 | 0.3065 | 0.0393 | 0.4750 | 6.8 | |
22 | 5gmd:A | 325 | 38 | 0.1774 | 0.0338 | 0.2895 | 7.4 | 5gme:A |
23 | 4yd9:A | 1656 | 20 | 0.1452 | 0.0054 | 0.4500 | 8.4 | 4yd9:D, 4yd9:G, 4yd9:J, 4yd9:M, 4yd9:P, 4yd9:S, 4yd9:V, 4yd9:Y, 4yd9:b |
24 | 3uk6:L | 233 | 27 | 0.1452 | 0.0386 | 0.3333 | 8.9 | |
25 | 3wnb:A | 361 | 16 | 0.1613 | 0.0277 | 0.6250 | 9.9 | 3wnc:A |