BioLiP

>protein
MKLFRVVKRGYYISYAILDNSTIIRLDEDPIKALMRYSENKEVLGDRVTGIDYQSLLKSFQINDIRITKPIDPPEVWGSG
ISYENVAKILGKTIYEKVYDAVRPEIFFKATPNRCVGHGEAIAVRSDSEWTLPEPELAVVLDSNGKILGYTIMDDVSARD
LEAENPLYLPQSKIYAGCCAFGPVIVTSDEIKNPYSLDITLKIVREGRVFFEGSVNTNKMRRKIEEQIQYLIRDNPIPDG
TILTTGTAIVPGRDKGLKDEDIVEITISNIGTLITPVKKRRK

The query sequence (length=282) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bqb:X	291	291	1.0000	0.9691	0.9691	0.0	3bqb:A, 3bqb:Z, 3bqb:Y, 2q1a:X, 2q1c:X, 2q1d:X
2	6iym:A	277	190	0.1986	0.2022	0.2947	5.94e-14	6iym:B
3	4dbh:A	269	234	0.2270	0.2379	0.2735	1.30e-13	4dbf:A, 4dbf:B, 4dbh:B
4	8sky:B	303	233	0.2305	0.2145	0.2790	6.10e-13	8sky:A, 8sut:A, 8sut:B, 8suu:A, 8suu:B
5	3qdf:A	252	236	0.2376	0.2659	0.2839	7.63e-09
6	8gsr:A	290	220	0.2057	0.2000	0.2636	1.66e-08	8gsr:B, 8gsr:C, 8gsr:D, 8gst:A, 8gst:B, 8gst:C, 8gst:D
7	6j5x:A	280	217	0.1879	0.1893	0.2442	2.97e-06	6j5x:B
8	6v77:B	279	207	0.1950	0.1971	0.2657	5.94e-05	6v77:A
9	6sbi:A	216	159	0.1454	0.1898	0.2579	0.005	6sbi:B, 6sbi:C, 6sbi:D, 6sbj:A, 6sbj:B, 6sbj:C, 6sbj:D
10	3r6o:A	265	205	0.1738	0.1849	0.2390	0.013
11	6jvw:B	264	101	0.0993	0.1061	0.2772	0.22	6jvw:A
12	6a2f:A	358	40	0.0461	0.0363	0.3250	0.29	6a2f:B

[Back]