MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPR
QHRLDKITHACR
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wpk:A | 146 | 92 | 0.9674 | 0.6096 | 0.9674 | 9.71e-64 | 1adn:A, 1eyf:A, 1u8b:A, 1zgw:A |
2 | 4bga:C | 322 | 37 | 0.1413 | 0.0404 | 0.3514 | 0.71 | 4bg8:A, 4bg8:B, 4bg9:A, 4bga:A, 4bga:D, 4bga:B, 4bgb:A, 4bgb:B |